Identifiers and Description
Gene Model Identifier
Contig3736.0.0.g90Standard Name
PFD4bAliases
Contig3736_0_0_g90Description
Prefoldin subunitGenome Browser
![]()
Genome Browser (Micronucleus)
Micronuclear Genome Browser
Gene Ontology Annotations
Cellular Component
- fibrinogen complex (IEA) | GO:0005577
- prefoldin complex (IEA) | GO:0016272
- integral component of membrane (IEA) | GO:0016021
- viral capsid (IEA) | GO:0019028
- cytoplasm (IEA) | GO:0005737
Molecular Function
- cob(I)yrinic acid a,c-diamide adenosyltransferase activity (IEA) | GO:0008817
- protein kinase binding (IEA) | GO:0019901
- nucleotide binding (IEA) | GO:0000166
- signaling receptor binding (IEA) | GO:0005102
- unfolded protein binding (IEA) | GO:0051082
- tetrahydromethanopterin S-methyltransferase activity (IEA) | GO:0030269
- serine-tRNA ligase activity (IEA) | GO:0004828
- protein binding, bridging (IEA) | GO:0030674
- DNA-binding transcription factor activity (IEA) | GO:0003700
- ATP binding (IEA) | GO:0005524
- sequence-specific DNA binding (IEA) | GO:0043565
- protein dimerization activity (IEA) | GO:0046983
- hydrolase activity, acting on acid anhydrides (IEA) | GO:0016817
- protein binding (IEA) | GO:0005515
Biological Process
- regulation of transcription, DNA-templated (IEA) | GO:0006355
- RNA processing (IEA) | GO:0006396
- cobalamin biosynthetic process (IEA) | GO:0009236
- cell cycle (IEA) | GO:0007049
- protein folding (IEA) | GO:0006457
- methanogenesis (IEA) | GO:0015948
- signal transduction (IEA) | GO:0007165
- seryl-tRNA aminoacylation (IEA) | GO:0006434
- platelet activation (IEA) | GO:0030168
- protein polymerization (IEA) | GO:0051258
Domains
- ( pfam01920 ) Prefoldin subunit
- ( pfam02181 ) Formin Homology 2 Domain
- ( pfam12128 ) Protein of unknown function (DUF3584)
- ( pfam01923 ) Cobalamin adenosyltransferase
- ( pfam05531 ) Nucleopolyhedrovirus P10 protein
- ( pfam05565 ) Siphovirus Gp157
- ( pfam02996 ) Prefoldin subunit
- ( pfam12725 ) Protein of unknown function (DUF3810)
- ( pfam09429 ) WW domain binding protein 11
- ( pfam12917 ) HD containing hydrolase-like enzyme
- ( pfam12329 ) TATA element modulatory factor 1 DNA binding
- ( pfam05879 ) Root hair defective 3 GTP-binding protein (RHD3)
- ( pfam12699 ) phiKZ-like phage internal head proteins
- ( pfam03961 ) Protein of unknown function (DUF342)
- ( pfam12644 ) Protein of unknown function (DUF3782)
- ( pfam04210 ) Tetrahydromethanopterin S-methyltransferase, subunit G
- ( pfam12443 ) AT-hook-containing transcription factor
- ( pfam05103 ) DivIVA protein
- ( pfam06013 ) Proteins of 100 residues with WXG
- ( pfam04201 ) Tumour protein D52 family
- ( pfam08702 ) Fibrinogen alpha/beta chain family
- ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
- ( pfam06103 ) Bacterial protein of unknown function (DUF948)
- ( pfam05667 ) Protein of unknown function (DUF812)
- ( pfam00170 ) bZIP transcription factor
- ( pfam10267 ) Predicted transmembrane and coiled-coil 2 protein
- ( pfam04102 ) SlyX
- ( pfam04977 ) Septum formation initiator
- ( pfam05597 ) Poly(hydroxyalcanoate) granule associated protein (phasin)
- ( pfam03234 ) Cdc37 N terminal kinase binding
- ( pfam13600 ) N-terminal domain of unknown function (DUF4140)
- ( pfam08182 ) Pedibin/Hym-346 family
- ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
- ( pfam04837 ) MbeB-like, N-term conserved region
- ( pfam00435 ) Spectrin repeat
- ( pfam04156 ) IncA protein
- ( pfam08286 ) Spc24 subunit of Ndc80
Gene Expression Profile
No expression data available at this time.
Homologs
Source Identifier Score Description T. thermophila TTHERM_00471350 0.000000019990673443141236 hypothetical protein
General Information
No Data fetched for General Information
Associated Literature
No Data fetched for Associated Literature
Sequences
>Contig3736.0.0.g90(coding)
ATGAAGGCCCGCGATTTAAAGGCTGACATCAAGGAACTCAAGGAAAAGCTCGATGCTCTT
CAAGACGCAGAGTAGATGATTGAAGAGTCATTCGGTGAAGGTCTGAAGTTAATGATTGGA
GAGGCCTTAGTAGAAGTAGACGAGGAGACCGCCACAAAATATTAACAAAGAATTATGGAG
GAGACCCAAGAGGAGCTCGAGAAGCTTGGAGATTTGCTTGACGAGCACGAAGGCGAGATG
AAGAACTTAAAGAGTTATCTATATGCTAGATTCGGAACAGCTATCAATCTTGAGGAAGAA
TGA>Contig3736.0.0.g90(protein)
MKARDLKADIKELKEKLDALQDAEQMIEESFGEGLKLMIGEALVEVDEETATKYQQRIME
ETQEELEKLGDLLDEHEGEMKNLKSYLYARFGTAINLEEE