Identifiers and Description

Gene Model Identifier

Contig3736.0.0.g90

Standard Name

PFD4b

Aliases

Contig3736_0_0_g90

Description

Prefoldin subunit

Genome Browser

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

• integral component of membrane (IEA) | GO:0016021
• viral capsid (IEA) | GO:0019028
• cytoplasm (IEA) | GO:0005737
• fibrinogen complex (IEA) | GO:0005577
• prefoldin complex (IEA) | GO:0016272

Molecular Function

• protein dimerization activity (IEA) | GO:0046983
• hydrolase activity, acting on acid anhydrides (IEA) | GO:0016817
• protein binding (IEA) | GO:0005515
• cob(I)yrinic acid a,c-diamide adenosyltransferase activity (IEA) | GO:0008817
• protein kinase binding (IEA) | GO:0019901
• nucleotide binding (IEA) | GO:0000166
• signaling receptor binding (IEA) | GO:0005102
• unfolded protein binding (IEA) | GO:0051082
• serine-tRNA ligase activity (IEA) | GO:0004828
• tetrahydromethanopterin S-methyltransferase activity (IEA) | GO:0030269
• protein binding, bridging (IEA) | GO:0030674
• DNA-binding transcription factor activity (IEA) | GO:0003700
• ATP binding (IEA) | GO:0005524
• sequence-specific DNA binding (IEA) | GO:0043565

Biological Process

• seryl-tRNA aminoacylation (IEA) | GO:0006434
• platelet activation (IEA) | GO:0030168
• protein polymerization (IEA) | GO:0051258
• regulation of transcription, DNA-templated (IEA) | GO:0006355
• RNA processing (IEA) | GO:0006396
• cobalamin biosynthetic process (IEA) | GO:0009236
• cell cycle (IEA) | GO:0007049
• protein folding (IEA) | GO:0006457
• methanogenesis (IEA) | GO:0015948
• signal transduction (IEA) | GO:0007165

Domains

• ( pfam01920 ) Prefoldin subunit
• ( pfam02181 ) Formin Homology 2 Domain
• ( pfam12128 ) Protein of unknown function (DUF3584)
• ( pfam01923 ) Cobalamin adenosyltransferase
• ( pfam05531 ) Nucleopolyhedrovirus P10 protein
• ( pfam05565 ) Siphovirus Gp157
• ( pfam02996 ) Prefoldin subunit
• ( pfam12725 ) Protein of unknown function (DUF3810)
• ( pfam09429 ) WW domain binding protein 11
• ( pfam12917 ) HD containing hydrolase-like enzyme
• ( pfam12329 ) TATA element modulatory factor 1 DNA binding
• ( pfam05879 ) Root hair defective 3 GTP-binding protein (RHD3)
• ( pfam12699 ) phiKZ-like phage internal head proteins
• ( pfam03961 ) Protein of unknown function (DUF342)
• ( pfam12644 ) Protein of unknown function (DUF3782)
• ( pfam04210 ) Tetrahydromethanopterin S-methyltransferase, subunit G
• ( pfam12443 ) AT-hook-containing transcription factor
• ( pfam05103 ) DivIVA protein
• ( pfam06013 ) Proteins of 100 residues with WXG
• ( pfam04201 ) Tumour protein D52 family
• ( pfam08702 ) Fibrinogen alpha/beta chain family
• ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
• ( pfam06103 ) Bacterial protein of unknown function (DUF948)
• ( pfam05667 ) Protein of unknown function (DUF812)
• ( pfam00170 ) bZIP transcription factor
• ( pfam10267 ) Predicted transmembrane and coiled-coil 2 protein
• ( pfam04102 ) SlyX
• ( pfam04977 ) Septum formation initiator
• ( pfam05597 ) Poly(hydroxyalcanoate) granule associated protein (phasin)
• ( pfam03234 ) Cdc37 N terminal kinase binding
• ( pfam13600 ) N-terminal domain of unknown function (DUF4140)
• ( pfam08182 ) Pedibin/Hym-346 family
• ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
• ( pfam04837 ) MbeB-like, N-term conserved region
• ( pfam00435 ) Spectrin repeat
• ( pfam04156 ) IncA protein
• ( pfam08286 ) Spc24 subunit of Ndc80

Gene Expression Profile

Homologs

Source	Identifier	Score	Description
T. thermophila	TTHERM_00471350	0.000000019990673443141236	hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3736.0.0.g90(coding)
ATGAAGGCCCGCGATTTAAAGGCTGACATCAAGGAACTCAAGGAAAAGCTCGATGCTCTT
CAAGACGCAGAGTAGATGATTGAAGAGTCATTCGGTGAAGGTCTGAAGTTAATGATTGGA
GAGGCCTTAGTAGAAGTAGACGAGGAGACCGCCACAAAATATTAACAAAGAATTATGGAG
GAGACCCAAGAGGAGCTCGAGAAGCTTGGAGATTTGCTTGACGAGCACGAAGGCGAGATG
AAGAACTTAAAGAGTTATCTATATGCTAGATTCGGAACAGCTATCAATCTTGAGGAAGAA
TGA

>Contig3736.0.0.g90(protein)
MKARDLKADIKELKEKLDALQDAEQMIEESFGEGLKLMIGEALVEVDEETATKYQQRIME
ETQEELEKLGDLLDEHEGEMKNLKSYLYARFGTAINLEEE