Identifiers and Description

Gene Model Identifier

Contig15069.0.g61

Standard Name

PFD4a

Aliases

Contig15069_0_g61

Description

Prefoldin subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01920 ) Prefoldin subunit
  • ( pfam02181 ) Formin Homology 2 Domain
  • ( pfam12128 ) Protein of unknown function (DUF3584)
  • ( pfam01923 ) Cobalamin adenosyltransferase
  • ( pfam05531 ) Nucleopolyhedrovirus P10 protein
  • ( pfam05565 ) Siphovirus Gp157
  • ( pfam12725 ) Protein of unknown function (DUF3810)
  • ( pfam02996 ) Prefoldin subunit
  • ( pfam09429 ) WW domain binding protein 11
  • ( pfam05879 ) Root hair defective 3 GTP-binding protein (RHD3)
  • ( pfam12329 ) TATA element modulatory factor 1 DNA binding
  • ( pfam12443 ) AT-hook-containing transcription factor
  • ( pfam04210 ) Tetrahydromethanopterin S-methyltransferase, subunit G
  • ( pfam12699 ) phiKZ-like phage internal head proteins
  • ( pfam03961 ) Protein of unknown function (DUF342)
  • ( pfam06013 ) Proteins of 100 residues with WXG
  • ( pfam05103 ) DivIVA protein
  • ( pfam08702 ) Fibrinogen alpha/beta chain family
  • ( pfam06103 ) Bacterial protein of unknown function (DUF948)
  • ( pfam04201 ) Tumour protein D52 family
  • ( pfam05667 ) Protein of unknown function (DUF812)
  • ( pfam10267 ) Predicted transmembrane and coiled-coil 2 protein
  • ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
  • ( pfam00170 ) bZIP transcription factor
  • ( pfam04102 ) SlyX
  • ( pfam05340 ) Protein of unknown function (DUF740)
  • ( pfam12644 ) Protein of unknown function (DUF3782)
  • ( pfam04977 ) Septum formation initiator
  • ( pfam05597 ) Poly(hydroxyalcanoate) granule associated protein (phasin)
  • ( pfam03234 ) Cdc37 N terminal kinase binding
  • ( pfam04837 ) MbeB-like, N-term conserved region
  • ( pfam13600 ) N-terminal domain of unknown function (DUF4140)
  • ( pfam07028 ) Protein of unknown function (DUF1319)
  • ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
  • ( pfam08182 ) Pedibin/Hym-346 family
  • ( pfam00435 ) Spectrin repeat
  • ( pfam04156 ) IncA protein
  • ( pfam08286 ) Spc24 subunit of Ndc80

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004713500.000000030002053728821195hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15069.0.g61(coding)
ATGAAGGCCCGCGATTTAAAAGCTGACATCAAGGAACTCAAGGAAAAGCTCGATGCACTT
CAAGACGCAGAGTAGATGATTGAAGAGTCATTCGGTGAAGGTCTGAAGTTAATGATTGGA
GAGGCCTTAGTTGAAGTAGACGAGGAGACCGCCACAAAATATTAACAAAAAATTATGGAG
GAGACCTAAGAGGAGCTCGAAAAGCTTGGAGATTTGCTTGACGAGCACGAAGGCGAGATG
AAGAACTTAAAGAGTTACCTATATGCTAGATTTGGAACAGCCATCAATCTTGAGGAAGAA
TGA


>Contig15069.0.g61(protein)
MKARDLKADIKELKEKLDALQDAEQMIEESFGEGLKLMIGEALVEVDEETATKYQQKIME
ETQEELEKLGDLLDEHEGEMKNLKSYLYARFGTAINLEEE