Identifiers and Description
Gene Model Identifier
Contig12284.0.g19Standard Name
PFD2bAliases
Contig12284_0_g19Description
Prefoldin subunitGenome Browser
![]()
Genome Browser (Micronucleus)
Micronuclear Genome Browser
Gene Ontology Annotations
Cellular Component
- nucleus (IEA) | GO:0005634
- cytoplasm (IEA) | GO:0005737
- proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177
- viral envelope (IEA) | GO:0019031
- proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178
- nuclear pore (IEA) | GO:0005643
- fibrinogen complex (IEA) | GO:0005577
- condensed chromosome kinetochore (IEA) | GO:0000777
- prefoldin complex (IEA) | GO:0016272
Molecular Function
- ATPase activity, coupled to transmembrane movement of substances (IEA) | GO:0042626
- kinetochore binding (IEA) | GO:0043515
- nucleotide binding (IEA) | GO:0000166
- serine-tRNA ligase activity (IEA) | GO:0004828
- unfolded protein binding (IEA) | GO:0051082
- ATP binding (IEA) | GO:0005524
- signaling receptor binding (IEA) | GO:0005102
- proton transmembrane transporter activity (IEA) | GO:0015078
- hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
- protein binding, bridging (IEA) | GO:0030674
- protein binding (IEA) | GO:0005515
Biological Process
- signal transduction (IEA) | GO:0007165
- positive regulation of autophagy (IEA) | GO:0010508
- fusion of virus membrane with host plasma membrane (IEA) | GO:0019064
- ATP synthesis coupled proton transport (IEA) | GO:0015986
- platelet activation (IEA) | GO:0030168
- protein import into nucleus (IEA) | GO:0006606
- chromosome segregation (IEA) | GO:0007059
- protein polymerization (IEA) | GO:0051258
- cell cycle (IEA) | GO:0007049
- cell division (IEA) | GO:0051301
- protein folding (IEA) | GO:0006457
- seryl-tRNA aminoacylation (IEA) | GO:0006434
- ATP hydrolysis coupled proton transport (IEA) | GO:0015991
Domains
- ( pfam01920 ) Prefoldin subunit
- ( pfam08656 ) DASH complex subunit Dad3
- ( pfam11559 ) Afadin- and alpha -actinin-Binding
- ( pfam04102 ) SlyX
- ( pfam02996 ) Prefoldin subunit
- ( pfam02050 ) Flagellar FliJ protein
- ( pfam02346 ) Chordopoxvirus fusion protein
- ( pfam04012 ) PspA/IM30 family
- ( pfam05218 ) Protein of unknown function (DUF713)
- ( pfam07902 ) gp58-like protein
- ( pfam10146 ) Zinc finger-containing protein
- ( pfam05837 ) Centromere protein H (CENP-H)
- ( pfam12329 ) TATA element modulatory factor 1 DNA binding
- ( pfam04156 ) IncA protein
- ( pfam03961 ) Protein of unknown function (DUF342)
- ( pfam12296 ) Hydrophobic surface binding protein A
- ( pfam04849 ) HAP1 N-terminal conserved region
- ( pfam08614 ) Autophagy protein 16 (ATG16)
- ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
- ( pfam04859 ) Plant protein of unknown function (DUF641)
- ( pfam07309 ) Flagellar protein FlaF
- ( pfam08286 ) Spc24 subunit of Ndc80
- ( pfam08647 ) BRE1 E3 ubiquitin ligase
- ( pfam14362 ) Domain of unknown function (DUF4407)
- ( pfam08898 ) Domain of unknown function (DUF1843)
- ( pfam01496 ) V-type ATPase 116kDa subunit family
- ( pfam08317 ) Spc7 kinetochore protein
- ( pfam04977 ) Septum formation initiator
- ( pfam08112 ) ATP synthase epsilon subunit
- ( pfam13166 ) AAA domain
- ( pfam08702 ) Fibrinogen alpha/beta chain family
- ( pfam07926 ) TPR/MLP1/MLP2-like protein
- ( pfam08391 ) Ly49-like protein, N-terminal region
- ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
- ( pfam07889 ) Protein of unknown function (DUF1664)
- ( pfam10046 ) Biogenesis of lysosome-related organelles complex-1 subunit 2
- ( pfam09744 ) JNK SAPK-associated protein-1
- ( pfam13863 ) Domain of unknown function (DUF4200)
- ( pfam10828 ) Protein of unknown function (DUF2570)
- ( pfam05103 ) DivIVA protein
- ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
- ( pfam00435 ) Spectrin repeat
- ( pfam09403 ) Adhesion protein FadA
- ( pfam06156 ) Protein of unknown function (DUF972)
- ( pfam12711 ) Kinesin motor
Gene Expression Profile
No expression data available at this time.
Homologs
Source Identifier Score Description T. thermophila TTHERM_00077790 9.997764199084386e-16 KE2 family protein
SGD YEL003W 0.0000000000499999055251093 GIM4 SGDID:S000000729, Chr V f
rom 148176-148194,148283-...
General Information
No Data fetched for General Information
Associated Literature
No Data fetched for Associated Literature
Sequences
>Contig12284.0.g19(coding)
ATGGAGAGAACTTAACCCGCCCAAGAACCAACTGAAGGCCAAGTCATTCAAAACTATCAG
AATCTTCAGAGAGAGACTTCCCTTTTAGTTGCCAAGATTATTGAAATCGAAGATGAAAAG
AAGGAGCATGAACTTGTATTGGAAACAATTAAGGATTTAGAAGATGATAGAAAATGCTGG
AGAATGGTCAATGGAGTTCTTTTTGAAAAGACCAAGGGAGAAACCGTTCCCGAACTTGTT
GCTGAAATTTCAAACATGGAAAATGTCATCAAGCAAATCACTGATGCATTGAGTCAGAAG
AAGGGAGAGATCTCAAGATTAGAGCAGAATTACGATAGCTTAATGAAACAAGCCAAGGAT
AGACAAGAAGAAGTCAAGAGCGAAGTTAAGGCTGGAGGTGTCCTTGTTCAATGA>Contig12284.0.g19(protein)
MERTQPAQEPTEGQVIQNYQNLQRETSLLVAKIIEIEDEKKEHELVLETIKDLEDDRKCW
RMVNGVLFEKTKGETVPELVAEISNMENVIKQITDALSQKKGEISRLEQNYDSLMKQAKD
RQEEVKSEVKAGGVLVQ