Identifiers and Description

Gene Model Identifier

Contig12284.0.g19

Standard Name

PFD2b

Aliases

Contig12284_0_g19

Description

Prefoldin subunit

Genome Browser

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

• viral envelope (IEA) | GO:0019031
• proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178
• nuclear pore (IEA) | GO:0005643
• fibrinogen complex (IEA) | GO:0005577
• condensed chromosome kinetochore (IEA) | GO:0000777
• prefoldin complex (IEA) | GO:0016272
• nucleus (IEA) | GO:0005634
• cytoplasm (IEA) | GO:0005737
• proton-transporting two-sector ATPase complex, proton-transporting domain (IEA) | GO:0033177

Molecular Function

• kinetochore binding (IEA) | GO:0043515
• nucleotide binding (IEA) | GO:0000166
• serine-tRNA ligase activity (IEA) | GO:0004828
• unfolded protein binding (IEA) | GO:0051082
• ATP binding (IEA) | GO:0005524
• signaling receptor binding (IEA) | GO:0005102
• proton transmembrane transporter activity (IEA) | GO:0015078
• hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
• protein binding, bridging (IEA) | GO:0030674
• protein binding (IEA) | GO:0005515
• ATPase activity, coupled to transmembrane movement of substances (IEA) | GO:0042626

Biological Process

• platelet activation (IEA) | GO:0030168
• protein import into nucleus (IEA) | GO:0006606
• chromosome segregation (IEA) | GO:0007059
• protein polymerization (IEA) | GO:0051258
• cell cycle (IEA) | GO:0007049
• cell division (IEA) | GO:0051301
• protein folding (IEA) | GO:0006457
• seryl-tRNA aminoacylation (IEA) | GO:0006434
• ATP hydrolysis coupled proton transport (IEA) | GO:0015991
• signal transduction (IEA) | GO:0007165
• positive regulation of autophagy (IEA) | GO:0010508
• fusion of virus membrane with host plasma membrane (IEA) | GO:0019064
• ATP synthesis coupled proton transport (IEA) | GO:0015986

Domains

• ( pfam01920 ) Prefoldin subunit
• ( pfam08656 ) DASH complex subunit Dad3
• ( pfam11559 ) Afadin- and alpha -actinin-Binding
• ( pfam04102 ) SlyX
• ( pfam02996 ) Prefoldin subunit
• ( pfam02050 ) Flagellar FliJ protein
• ( pfam02346 ) Chordopoxvirus fusion protein
• ( pfam04012 ) PspA/IM30 family
• ( pfam05218 ) Protein of unknown function (DUF713)
• ( pfam07902 ) gp58-like protein
• ( pfam10146 ) Zinc finger-containing protein
• ( pfam05837 ) Centromere protein H (CENP-H)
• ( pfam12329 ) TATA element modulatory factor 1 DNA binding
• ( pfam04156 ) IncA protein
• ( pfam03961 ) Protein of unknown function (DUF342)
• ( pfam12296 ) Hydrophobic surface binding protein A
• ( pfam04849 ) HAP1 N-terminal conserved region
• ( pfam08614 ) Autophagy protein 16 (ATG16)
• ( pfam02403 ) Seryl-tRNA synthetase N-terminal domain
• ( pfam04859 ) Plant protein of unknown function (DUF641)
• ( pfam07309 ) Flagellar protein FlaF
• ( pfam08286 ) Spc24 subunit of Ndc80
• ( pfam08647 ) BRE1 E3 ubiquitin ligase
• ( pfam14362 ) Domain of unknown function (DUF4407)
• ( pfam08898 ) Domain of unknown function (DUF1843)
• ( pfam01496 ) V-type ATPase 116kDa subunit family
• ( pfam08317 ) Spc7 kinetochore protein
• ( pfam04977 ) Septum formation initiator
• ( pfam08112 ) ATP synthase epsilon subunit
• ( pfam13166 ) AAA domain
• ( pfam08702 ) Fibrinogen alpha/beta chain family
• ( pfam07926 ) TPR/MLP1/MLP2-like protein
• ( pfam08391 ) Ly49-like protein, N-terminal region
• ( pfam10186 ) UV radiation resistance protein and autophagy-related subunit 14
• ( pfam07889 ) Protein of unknown function (DUF1664)
• ( pfam10046 ) Biogenesis of lysosome-related organelles complex-1 subunit 2
• ( pfam09744 ) JNK SAPK-associated protein-1
• ( pfam13863 ) Domain of unknown function (DUF4200)
• ( pfam10828 ) Protein of unknown function (DUF2570)
• ( pfam05103 ) DivIVA protein
• ( pfam07106 ) Tat binding protein 1(TBP-1)-interacting protein (TBPIP)
• ( pfam00435 ) Spectrin repeat
• ( pfam09403 ) Adhesion protein FadA
• ( pfam06156 ) Protein of unknown function (DUF972)
• ( pfam12711 ) Kinesin motor

Gene Expression Profile

Homologs

Source	Identifier	Score	Description
T. thermophila	TTHERM_00077790	9.997764199084386e-16	KE2 family protein
SGD	YEL003W	0.0000000000499999055251093	GIM4 SGDID:S000000729, Chr V f rom 148176-148194,148283-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12284.0.g19(coding)
ATGGAGAGAACTTAACCCGCCCAAGAACCAACTGAAGGCCAAGTCATTCAAAACTATCAG
AATCTTCAGAGAGAGACTTCCCTTTTAGTTGCCAAGATTATTGAAATCGAAGATGAAAAG
AAGGAGCATGAACTTGTATTGGAAACAATTAAGGATTTAGAAGATGATAGAAAATGCTGG
AGAATGGTCAATGGAGTTCTTTTTGAAAAGACCAAGGGAGAAACCGTTCCCGAACTTGTT
GCTGAAATTTCAAACATGGAAAATGTCATCAAGCAAATCACTGATGCATTGAGTCAGAAG
AAGGGAGAGATCTCAAGATTAGAGCAGAATTACGATAGCTTAATGAAACAAGCCAAGGAT
AGACAAGAAGAAGTCAAGAGCGAAGTTAAGGCTGGAGGTGTCCTTGTTCAATGA

>Contig12284.0.g19(protein)
MERTQPAQEPTEGQVIQNYQNLQRETSLLVAKIIEIEDEKKEHELVLETIKDLEDDRKCW
RMVNGVLFEKTKGETVPELVAEISNMENVIKQITDALSQKKGEISRLEQNYDSLMKQAKD
RQEEVKSEVKAGGVLVQ