Identifiers and Description

Gene Model Identifier

Contig12284.0.g19

Standard Name

PFD2b

Aliases

Contig12284_0_g19

Description

Prefoldin subunit

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000777909.997764199084386e-16KE2 family protein
SGDYEL003W0.0000000000499999055251093GIM4 SGDID:S000000729, Chr V f
rom 148176-148194,148283-...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12284.0.g19(coding)
ATGGAGAGAACTTAACCCGCCCAAGAACCAACTGAAGGCCAAGTCATTCAAAACTATCAG
AATCTTCAGAGAGAGACTTCCCTTTTAGTTGCCAAGATTATTGAAATCGAAGATGAAAAG
AAGGAGCATGAACTTGTATTGGAAACAATTAAGGATTTAGAAGATGATAGAAAATGCTGG
AGAATGGTCAATGGAGTTCTTTTTGAAAAGACCAAGGGAGAAACCGTTCCCGAACTTGTT
GCTGAAATTTCAAACATGGAAAATGTCATCAAGCAAATCACTGATGCATTGAGTCAGAAG
AAGGGAGAGATCTCAAGATTAGAGCAGAATTACGATAGCTTAATGAAACAAGCCAAGGAT
AGACAAGAAGAAGTCAAGAGCGAAGTTAAGGCTGGAGGTGTCCTTGTTCAATGA


>Contig12284.0.g19(protein)
MERTQPAQEPTEGQVIQNYQNLQRETSLLVAKIIEIEDEKKEHELVLETIKDLEDDRKCW
RMVNGVLFEKTKGETVPELVAEISNMENVIKQITDALSQKKGEISRLEQNYDSLMKQAKD
RQEEVKSEVKAGGVLVQ