Identifiers and Description

Gene Model Identifier

Contig18889.0.g35

Standard Name

PET127

Aliases

Contig18889_0_g35

Description

Mitochondrial protein Pet127

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam08634 ) Mitochondrial protein Pet127
  • ( pfam01939 ) Protein of unknown function DUF91

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010793204.000944328304913e-112hypothetical protein
SGDYOR017W2.0009605191578312e-25PET127 SGDID:S000005543, Chr X
V from 361412-363814, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18889.0.g35(coding)
ATGAAGTAGCTTTTTGTAAAGATAAGACAGCAAAAGTCACTTAATACTCAATTACTTAGT
TATTCCAAAAGATGTAACTCTGGAAAGCCCTTAGTAGATGCTAATGATTAAAGCAACGAT
GACATAATGATGAAAATGCCAGATTTTTCAAAATAAAAAGCGAGATTCGAATAGACAAGC
CAAGATTAGTAATAATAAAACGATGGTAGATAGTAATAATAGCAAAAAAATAAACCCTAT
CACTATGAGTCAAAAATAGATAAGTCAAGGGAATATAGAGCGAAATTGCCTTAAAGCAGT
GGGGGGTAGCATTAAGCGGATAGGAGACCTAAGAGATACATGGATGAAAGTTTATAGATG
TATCTCTAGTAGAAAGGGAAATCAGCGTTTGAGAGTAAAATTAGAGAGAAATATGGCTCA
GAGATGTTTAACAATATCGAAAAGGCAACTATTGAGAAAATAAACAATCCAGTGAATGAA
GATTCTAAAAACTTGACATCAGGCAAGATAAATTCTTTCGATTCCCCAACGAATCTCTAC
GACGTAAAGAAAGTCATAAATTAGAATGTTTTCATGAAGAAAGCAAGCGTTTAAAGAATA
AGGTATTCATCTTTCCAAGACTTTCAAGATAAACATTCGTTGCTACCAGATTTTTACTTG
AATAGAGAAAGAGTCAGTTAGTTGTTAGATGTGCACAATAATGAAATCACACCAGTCACC
AACGACTGGCAAGATAAAAGCATTATTCCATAGTTAGCAAACGGCCTTGATATATGTCTT
AAGAATCCAGGTATTTTCCCAATTGAGACCATTAATGACTACAGTAAAGGAAAGTTAGGC
TCATTCTATACTAAACTTCCTCAATATTCTCAAATTAATGAAGAGTGTATCAGTCCTTAT
TACCCACCAGGATAAGACAAGAATCTTCAAAGAATGTGTCAGCAACTAGGAACAAAATAT
ATGATGTCCACTTCAACCATTTCATCAGTCCTCTCCCACATTTACTTCTGCCTTGCAAAC
TTCAAATCCCCTCATTTCAACAACTTATCAGAGCCCTACGACAGAGAGCCCTTGAAGTTT
ATGGTCTCCCAGAGAAAGCCAAACACAGTATTTTTGACGAAATCAGATAAGAACAAGAAA
GTATACTCTGTAGATGGTGACTCTGGCTTCATAGAGCCATCAAATGTGGTTTTACTAAAA
ATGGGAAAATATATGGAAAAGATGCTTACCACTTAGCACGATTTCTTCTCAGATCATTAC
GTTTTGGATTCAAGAACTAATAAGCCAAATAAGTAACTACCCAGTGGGGAGGCATATTAG
GAAGCAGATTATTTCAGGTATATGAAATCGGGTGGGTTGCTACTCAGATCTCAAATCGAT
TGTCAAGGAGTGGACAAAGATGGCAATGAAGTTGTGTTTGAATTGAAGACTAGAGCTACC
AGTGTGCTTCGTTATGAAATTCATAAATATATCGATTATCTTGACTATGAGATCAATAAA
TACAAGGGGAAGTTTCAAAGTTACGAGAGAGAATTCTATGATCTTGTTAGAGGTGGTTTC
TTGAAATATATTATGTAGTGCAAAATCGGTCAAATGTCTGGTGCAGTTATTGCATATCAT
AACACTCAAAAGATTTTTGGATTCGAGTACATAACTTTAAAAGACATGGAGAAGAGAGTT
TTTGGTTGTTCAGAATTTTCCGACATCATTTTCCAAAATTCCCTCGCTATGGTTGAGAAG
ATTTTCGACCATATCATTGAAGACCAAGATTCAATCAGTGACGCTTAATTTAAAGAATCA
GGTTCCAAGGGAACCCCATAAAATAAAATCTTTAAGATTGGTTTTTACGCAAATGAACAG
GAGAGATTACTGAATTTAATGGTTGAAGTATTCGATGACGATCAATTTTATCAGGAGAGA
TTCAGAAGCGTGTTGCCAGAGTATATGAGAGACCCAATCGATTACTATGTTTCACATAAA
ATACAACCATAAGTATATAAATACACAGTTGGCATCTATCCAGTTCTAAATGGTGTCTTC
GTTGATCACTCTCCTATATTATTCGAAGCAGGTGACAGTTTGGATGTAAAGTATGTTATA
CAGAAAGCAGGGAAGATTCATTTCAATGAATACATGAAGTTTTTGCATGAAGCATATAAA
TGTGACTCAATTAATATCGATAATGAATACGCAGGTACTTGGAGTTTCGTTGTGTGA


>Contig18889.0.g35(protein)
MKQLFVKIRQQKSLNTQLLSYSKRCNSGKPLVDANDQSNDDIMMKMPDFSKQKARFEQTS
QDQQQQNDGRQQQQQKNKPYHYESKIDKSREYRAKLPQSSGGQHQADRRPKRYMDESLQM
YLQQKGKSAFESKIREKYGSEMFNNIEKATIEKINNPVNEDSKNLTSGKINSFDSPTNLY
DVKKVINQNVFMKKASVQRIRYSSFQDFQDKHSLLPDFYLNRERVSQLLDVHNNEITPVT
NDWQDKSIIPQLANGLDICLKNPGIFPIETINDYSKGKLGSFYTKLPQYSQINEECISPY
YPPGQDKNLQRMCQQLGTKYMMSTSTISSVLSHIYFCLANFKSPHFNNLSEPYDREPLKF
MVSQRKPNTVFLTKSDKNKKVYSVDGDSGFIEPSNVVLLKMGKYMEKMLTTQHDFFSDHY
VLDSRTNKPNKQLPSGEAYQEADYFRYMKSGGLLLRSQIDCQGVDKDGNEVVFELKTRAT
SVLRYEIHKYIDYLDYEINKYKGKFQSYEREFYDLVRGGFLKYIMQCKIGQMSGAVIAYH
NTQKIFGFEYITLKDMEKRVFGCSEFSDIIFQNSLAMVEKIFDHIIEDQDSISDAQFKES
GSKGTPQNKIFKIGFYANEQERLLNLMVEVFDDDQFYQERFRSVLPEYMRDPIDYYVSHK
IQPQVYKYTVGIYPVLNGVFVDHSPILFEAGDSLDVKYVIQKAGKIHFNEYMKFLHEAYK
CDSINIDNEYAGTWSFVV