Identifiers and Description

Gene Model Identifier

Contig6540.0.g48

Standard Name

PES1a

Aliases

Contig6540_0_g48

Description

Pescadillo N-terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006284207.002255246328404e-132Pescadillo N-terminus family p
rotein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6540.0.g48(coding)
ATGGATACAAAAATATTGACAGGTTAGTTTGGCTAAAAGAGAGTCAATTGTTATATTTAA
TAGAACATTAAAATGGGAAAGAAAATAGCAAAGGGCAAAAAGGGAGAGAAGTCTCAGTAT
TTGACTCGTTCCAAAGCCATCCGTAAGCTGCAGCTCTCTTTGAAAGATTTTAGACGCCTC
TGCATCTTGAAGGGAGTATATCCCCGTGAACCAAAGAAGAAGTTCGAGGGAACTAATAAA
ACTTACTATCACGTGAAAGACATTAAGATCTTAATGCACGATAAGCTCTTGAACAAATTC
AGAGATTTGAAGGCACACGCAAAGAAATATAAGAAGCTGCAGAATCGTAAGGAAGGCAAG
TTAGCTGAAGACCACTTGAGGAAGCTACCTAAGTATTCCCTTAGTCATATTATCAAAGAG
AGATATCCTACATTCATTGATGCACTAAGAGATCTTGATGATGCTTTGTGTCTAATAAGT
CTTTTCGCAAATCTGCCACAACATCACACTCTTGAAATCACAAAAAAGGAAACTGAAGCT
TGCTCTAATGTTATCAAGGAATTCATGTTGTATTGCACTGTAACTCAATGCTATAAGAAG
GCCTTTTACTCAATTAAGGGTATTTACTATCAAGTAGAGATAATGGGGTAATCAATCACT
TGGATCAGTCCATATGCTTTCAATCAAAAACTGCCATTTGACATTGATTATAAGGTAATG
AGCACTTTCCTTGAATTTTACCTCGCTCTTCTTAAGTTTGTCAACCACAAACTATTTGTT
GATCTTGGCTTCAAACACCCACTTGATGTGAAATATGGATAAGATGAGAATAAGCTACAC
TTAGATGTTCAAGTAGTATAAAAATTACAGAACCAAGCAAGGAAAAAGTTTGATTAGGGA
TAGCAAGAGAAAGACTCATATCAAATATCAGAGGAATTCAAGCAAACTCCAGAGATGAAG
AAGCTTAATAAAAAGGAAGAGCAAAATAAGAGATAGAGAAATATGTTCACCAAGTGTGTA
TTCCTGCTAAGCAGAGAGACACCTGTGTACAGTTTGTAGTATTTGATCTTGTCATTTGGA
GGAGTATTTGCAACTGAGGATGATGAAGAATTCTTATAAAAGCATCCAGTAACTCACCAC
GTAATGGACAGACCTCTTGTTGGATCTAAACTACAGACTAACCGCGAGTATGTTTAACCT
CAATGGATTGTAGATTCTCTAAATAACTTACATCTATTACCAAGTCAACCATACAAGCCT
GGTCAAGCACCTCCTCCACACATGTCTCCATTCGTTGACGATTTGAAGGAAGGATATATC
CCCAGCAGGTAGAAGGAAATCAATGCTCTAAAGGGTGAGGTAGTTGAGGAGCCAGAGGAT
AATTAAGAAGAGAGTGAAGAAGAAGTTGAAGAGGTTAAGCCACAATCAAAGCAAGCGCAA
TCTAAGAAACAATAATCTAAGCAAGCAGACAATTAAGAAGAAGAATTACAGACTGCCAAA
TAAAACAATAAACCCAATAAATAACAACCAAATAAATCAAAAGAACAAGTTCAACCACCA
TCCAAATAAAAAGGAGACGCCGACTCTAGCAGTGATGAAGAAGGCAATGACTCCGAAGAG
GAAATTCTGAAACAAAAGAAGAAGAAAAACATGAAGCTGAAAAAGGAATTGCAGAAGGAG
CAAGAGGAGCTCGGAAAGATTTTGATGACAAAGAAGTAAAGGAGGTTGTATGACTAAGCT
GATAAGTCAAACCAAAAGAAAAAGGATATTGCTGCTAAGCTCAAGGAGAAGTCTAAGAAT
ATACAAAAATCAAAAGCACATAAATGA


>Contig6540.0.g48(protein)
MDTKILTGQFGQKRVNCYIQQNIKMGKKIAKGKKGEKSQYLTRSKAIRKLQLSLKDFRRL
CILKGVYPREPKKKFEGTNKTYYHVKDIKILMHDKLLNKFRDLKAHAKKYKKLQNRKEGK
LAEDHLRKLPKYSLSHIIKERYPTFIDALRDLDDALCLISLFANLPQHHTLEITKKETEA
CSNVIKEFMLYCTVTQCYKKAFYSIKGIYYQVEIMGQSITWISPYAFNQKLPFDIDYKVM
STFLEFYLALLKFVNHKLFVDLGFKHPLDVKYGQDENKLHLDVQVVQKLQNQARKKFDQG
QQEKDSYQISEEFKQTPEMKKLNKKEEQNKRQRNMFTKCVFLLSRETPVYSLQYLILSFG
GVFATEDDEEFLQKHPVTHHVMDRPLVGSKLQTNREYVQPQWIVDSLNNLHLLPSQPYKP
GQAPPPHMSPFVDDLKEGYIPSRQKEINALKGEVVEEPEDNQEESEEEVEEVKPQSKQAQ
SKKQQSKQADNQEEELQTAKQNNKPNKQQPNKSKEQVQPPSKQKGDADSSSDEEGNDSEE
EILKQKKKKNMKLKKELQKEQEELGKILMTKKQRRLYDQADKSNQKKKDIAAKLKEKSKN
IQKSKAHK