Identifiers and Description

Gene Model Identifier

Contig17990.0.g10

Standard Name

PELO

Aliases

Contig17990_0_g10

Description

eRF1 domain 2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007050401.0003926095686843e-81eRF1 domain 3 family protein
SGDYNL001W2.0005131442217614e-40DOM34 SGDID:S000004946, Chr XI
V from 627456-628616, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17990.0.g10(coding)
ATGATCGTTAGAGTGGCTCTTGAGATAGACACTGACGATGCCTGGAATCTCTATAACTTA
ATGAACATCGGTGATTTAGTCAAAGGTTCAGCTTACAGAAAGATATAAAAGGAATCATAT
TCTGGACTAGTTCAAAACATCAAGAGAAAGTTTGATTGTGTTCTTAGAGTTGAGTCCTTT
GAATTCGACCCTGAAGCTGATGCAATTCGTATTACAGGCATTAACGCACAGGAGAACAAA
TACTTGAAGTTAGGCTAGTATCAATCTATTGAAATACAAGCACCCAAGACACTCACTCTC
ATCAAGACTAATTTTGACATTGTTCATCATAAAAAGCTTAATGATGCTGTGGAAATGCAC
AACCTTGGACATGTTTGCGTGATCGTGATGGAAGAAGGAATAGCTCATTTATTCCTAGTT
GGCAAAAACACTTCTAAACTCAAGGCGAAAATAGAAAAAAGTATCTCAAAAAAGAAAGCA
TTCGCACAGCAACATGACAAGCAGAAAAATAAGTTCTTCGAGTAGGTTCTTCAAGCTTTG
ATTCAACATTTCGTTCAAGGTGCAAAGAACTTGAAATCTATTGTTGTTGGTTCACCAGGA
TTCGTGAAAGAAGCTTTTTATGAATATATGAAACAAGAATCTCAAAAATAACACAATGTG
TTCTTGAAGCAATGTTTGGACAGAATTATCCTCACTCATACTTCCAGTGGTTTTAAGCAT
TCTCTTCAAGAAGTAATTAACAGTAGAACTGTTTAAGATTAAATCAATAATCTCAGTGTT
TTCTCAGAGTCAGTGACACTTGAGAAGTTCTTCGAGATCCTTTCATTGGACCCAGACAGA
TGCTGTTACGGTTAAAGATCAGTAGACTTTGCAATGAAAGCTCAAGCTGTAGAAACTCTC
CTTATCTCAGACAAGCTGTTCAGAGCTAAAAATGTGGCCACAAGAAAGCTCTATGTAGGC
ATGGTCGAGGAAGCTGAAAGAAATGGTTTGAAAAATATCATTTTCAGTTCTATGAATCCT
TCAGGAGATAGATTGAACAACTTGTCTGGAGTAGCAGCCATCTTGAGATACCCACTTTAG
GGCTTGGACGATATAGACGAGGAGGATATCGACTTGGATGATTTGATAGAGCAGGAAGGT
GATCAGCAAGAAGAGAAGAAGGAAGAAGATGCCACTAAGAAACTCAGTTGGGATGAGCAG
TAGTTGGAGCTACTTCTCTAAGAAGTGGGGGATGAAGGAGATGGTGAAGAAGACGAGGAA
GATGATTCATGA


>Contig17990.0.g10(protein)
MIVRVALEIDTDDAWNLYNLMNIGDLVKGSAYRKIQKESYSGLVQNIKRKFDCVLRVESF
EFDPEADAIRITGINAQENKYLKLGQYQSIEIQAPKTLTLIKTNFDIVHHKKLNDAVEMH
NLGHVCVIVMEEGIAHLFLVGKNTSKLKAKIEKSISKKKAFAQQHDKQKNKFFEQVLQAL
IQHFVQGAKNLKSIVVGSPGFVKEAFYEYMKQESQKQHNVFLKQCLDRIILTHTSSGFKH
SLQEVINSRTVQDQINNLSVFSESVTLEKFFEILSLDPDRCCYGQRSVDFAMKAQAVETL
LISDKLFRAKNVATRKLYVGMVEEAERNGLKNIIFSSMNPSGDRLNNLSGVAAILRYPLQ
GLDDIDEEDIDLDDLIEQEGDQQEEKKEEDATKKLSWDEQQLELLLQEVGDEGDGEEDEE
DDS