Identifiers and Description

Gene Model Identifier

Contig11890.0.g110

Standard Name

PDCD4

Aliases

Contig11890_0_g110

Description

MA3 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11890.0.g110(coding)
ATGAAGTCAGGTAAAGCCACACTTAACCACGGCACCAGCAAGGGCCTCCACAATGACAGA
TAGAATGATGATCTTGACTATGCTTCGGACTCACCCACCGAAGAAGATTTGTTCAAATCC
TATGATGCCTATGAGAAAGAATTGATTGATGAGAGAAAACGCTTAGCACTCAACTCTGAA
GAGTTAGAAGACGTAGCAGGAAAGAAGCCAACTCCCATGACAGAGGAACAGGTAATGAAT
GTGTTGAAGGGGCATAGATTCAAATTTAGTCTAGACAGCCATTTCGAGTAGTATTCAACC
GAATCCAGAAAAATCGCAGAGAAAATCTTAAAAAGAAGCGAAGTTAACTTATAGAGAGGT
ATAGAGACTATCAAGCAGCATTTGCAAGATGTTTAAGAACCTCAGTACAGATCTGTATTC
TTAATGAGACTCCTACAAGTTTCCATTGAGCAAGTCAAGCCCAGAGAAGTAGCTGATTTA
GTGAAAAATGTCTTCATTGATGGAGTGATTACTAAACAATAAATTCGTAGAGGACTCGTT
AGATTGTTCTGGAGACTTGAGGACATCCTTCTTGACTACCCCAGAGCTAACCAGGTTCTA
GCTTAGATCATGGTCTTCCTTCACTTAAGATAAATAATGTCAAGCAAGATATTGACATAG
ATTCCCAGAGAAATAAGATAAAACCTTCTCGAGCAAGATTCTATCAAAGAACATTTCTCG
AAAGAAATAGAAGTACTACAAAGCGAAAGTGTCTATAGAGAACACATAAAAGCTGTCCTT
AAGCAATATTATTCAAGTTTGGATGAGGCAGATGTTAGATTATTCCTAGGCACTGAAATC
AAGGAAAAGAAATGGGAGATCTTCAATTATTTATTCATTAAGAAATCAATAGATATGGCT
CTAGATAAAAACTCAAATGAGAAAGATGCGTGCAGTAAATTATTATCAATGTGCACTTAA
GAATATAATTTTGGCAACAATGATTTCGGCTATGCTTTCGATGATTTACTATGGAACCAA
TCAGAGTACTCAGTTGATGTACCTTAATTCTGCAAACTGATTTCAGAGTTTATAGCCAAG
GCTATATATGATGGCGCTGTTACCTACAGATACATTACAGATGCTGAGTTGTCTTATCCA
GGTGAATAGGATGGAGAGGAAGAGAAGATTCTATAATCAGTATTGAACGTTCTCTCAGTA
ATGCCTCTGGATTATCACATGAAAAATCTCTGGAATCCTGCACTTTCAAATGAAGAACTT
TCTAAGAAATTCAAAAGCACAGTCTAAGAATTCCTTCAAAACTAGGACATCGATTATGTG
GGTAGATACATCAAAGATTTGAATTGCAACTATTACTATCATGAATTCGTCAAGAGAGCA
ATAGTATTAGTACTAGAGAAGGAAAATCACGAGTACTATGAATTGATTGTAAAGCTGCTT
GTCTCATTGAACCATCAATATGCTCTTTCTAAACATCAGATTGAGTTGGGACTTTAGAAG
ACCGATGCCTATATGGAAGAGTTAATCATTGACGTTCCTAAAGCACAAGAACACTATGAA
TTCATCAAGAGCAAGTTGTTGCAACATAAGCTAAACGAATGA


>Contig11890.0.g110(protein)
MKSGKATLNHGTSKGLHNDRQNDDLDYASDSPTEEDLFKSYDAYEKELIDERKRLALNSE
ELEDVAGKKPTPMTEEQVMNVLKGHRFKFSLDSHFEQYSTESRKIAEKILKRSEVNLQRG
IETIKQHLQDVQEPQYRSVFLMRLLQVSIEQVKPREVADLVKNVFIDGVITKQQIRRGLV
RLFWRLEDILLDYPRANQVLAQIMVFLHLRQIMSSKILTQIPREIRQNLLEQDSIKEHFS
KEIEVLQSESVYREHIKAVLKQYYSSLDEADVRLFLGTEIKEKKWEIFNYLFIKKSIDMA
LDKNSNEKDACSKLLSMCTQEYNFGNNDFGYAFDDLLWNQSEYSVDVPQFCKLISEFIAK
AIYDGAVTYRYITDAELSYPGEQDGEEEKILQSVLNVLSVMPLDYHMKNLWNPALSNEEL
SKKFKSTVQEFLQNQDIDYVGRYIKDLNCNYYYHEFVKRAIVLVLEKENHEYYELIVKLL
VSLNHQYALSKHQIELGLQKTDAYMEELIIDVPKAQEHYEFIKSKLLQHKLNE