Identifiers and Description

Gene Model Identifier

Contig5641.0.g70

Standard Name

PDCD11

Aliases

Contig5641_0_g70

Description

S1 RNA binding domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009619102.0005330067840427e-93S1 RNA binding domain containi
ng protein
SGDYMR229C1.999576471039937e-58RRP5 SGDID:S000004842, Chr XII
I from 731123-725934, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig5641.0.g70(coding)
ATGAAAACCAAAGCACCTAAATAGCAGAGTTAAGACTTCTTCCCAAGAAGTGCAAATAAC
TAGAAGACCAAGGGTTTTATATTCAACTAGGCACCAATCAATAAGAAATTGGCTTAAGAC
GAGCTCAAGCAAACCATGGCCTAGGATGTTTCTGAAGGAAAGACACATAAAACTGGAAAA
AAGAGATCAGCATTTATGGCCAAGTTGTATGAGGATGAAGCAATCGATGATGAGATGAGA
GTATTTGACATGGAGGGTGACGAAGATATTGTTGAAAAGGAAGTCGTTGAAGAAGAAGGC
AAAACTTCAAAGAGAGCCAATAAAGAACTTTCTAAAAAGAAAGGAGCCAAGACACATGTC
GATAAGACTAGTGAAGTAGCTGCAAATAAGATCAACAGACTCAAGTTCAATGTGGGAAGC
TTGGGACTTTTTGCCATTAGTGAAATCCAAACTAAGTATTTGATTGTCAACTATACTAGA
AATACTAAGGGATACGTGAGCTTAGAGGGATTAAGCCATTTGGCTGATAAATTCAAAATA
GGACAGTTTATCATCGCATCAGTTCTCTCAGCTGGCACTTCTAAATATAACACAGAGACC
AGTGGAAACAGAAACAAGAAATTACAGCTCACCATTTAGATTGATCACTTGAACAAATCT
TTGTCTGCTGAAAACTTAGCCCCAAATATGCTTTTGCAAGGTTTAGTTGAATCAAAGGAA
GCAAAGGGACATTTGATTAACTTTGGCTTGAAGGATAAAACAAAGGGATTCCTTCCATTC
ACCAATGACACTTAACATTTACAGATTGGATCTTTAGTCTAAGTTTTGATTAAGACAGTT
CTCGCAAGTTCAAAAGTAGCCAAGTGTGAATTCATTAATCAATCAGTTGAAGAATACCAT
TAATATATGAATGTCAAGGATATCACTATTCACAATCTCAAACCTGGATTTATGGTGAAC
TCTAAAGTCTCAAAGATCCTTGACAACGGTATTGAGTTGACTTTCTTAGGTGGCTTCAAG
GGAACCATTTTCACAGATCACTTGGACAAATCAGACCCCACTAAGTACAAGATTGGCGAA
AAGATTGGAGCTAGAGTGATCGCAGTAGATCCACAAGCTTAAAACGTTCAAATGTCTCTT
TTACCACACATCAAACAAATGAATGACAAGGTTGTCTATAATACTATGAAATAGAGCGGA
GTGCATGTAGGACAGATCATTGAAAAAGCAACCGTTGAAAAGGAACTTTATGGTGGCTCT
TACAAGGTCAAGTTCGGCAAGGATCAAATTGCATTCCTACACAAGAGTCATACTAAAGAA
GATGTTGTACCTGAAGAAGAAGAGGAAGAAGAAGAGATCCCAACTTAATCAAAAGACAAG
AAGCAAAAGGTAGCTAAGAAATCAGATGAGTTAGAGGTAGGCTAAAAACTTGAGAAGGTT
AGAGTCAAGGAAATCAATTATTTCGATGGGCTTCCAATCTTATCTATTAAAGAAGATATT
CTTAACAGTGCTACTTTAACTTACGAAGACCTTAAGTGCGGAGATTACATTAGCACAATG
GTTACAGAAGTTAATGAAGACAAGAAATTCGTTACTCTTCAAGTCAACGATTTCGTTAAG
GGTCGTTTATATCTTGAACATATGGCAGATTTCCCAATGAAGGTCATTCCACCTAAATAC
AAAGATCTCGGTAAGACTCTTAAGATGAGAGTGTTCAATGTTGACAAGAAAACCAGAACT
CTCGATTTTACTAGAAAAGACACACTTCTTAAGGCTAAAGTACCTGTATATCAAAGTTAC
AGAGAAGTTGAGAAAGGATCTAAGCTCTACGGTGTCATCGTTGGTGAAAACGAATATGGC
TATGTCGTTAAATCATTCGGAGGTATCAAGGGTCTCTTGACTTTCGCAGACATTAAAGCC
AACTCAAAGGGAAGCAAGAAGGATTTCAGTTCACTTAAATTCGGCTCAATCGTTAAGGCA
TATGTTCTCTTTAAAAAGAAGGATTAAGGAATGGCTCTTACTTTAGATAAGTCAAAGGCT
AAGGAATTGAGGGAAGAAGCTAGCAAGAATGGAAAGGACAAGAAGAGTAAGACTTAAGTG
ACAGGCCAATAAAACTAAGATAAGTTTGAAGATTTCCTTCCAACAGAAAGTGAAAATGAT
GCTCTCAAGGACAAGTATAAAACCTTCATGAAGGTATCTCAGGATAAAGCAAATATTGGT
AAAGTATAGCAATTTAGAGTTCTTGAACAGACTGAAAAATATCTAGTCTGCAAAAGTTTA
GAAGCAGTTAAGAAATCTTAAAACTATATTGCCATTCTCCCAAACATTTTGATAAACAAA
CATCATTAGCCATCATTTACCTTGGAAGATTTCACTTTCCAAGCAATTACTTTAGAAGTT
ACCTCGGACAGTTTCCCAATCATCTCATCTCAATATGATTTGATTTAATTAAAAGACTCA
ATTCCAAGAAAGAACGCAGACATTAGCACTGATGCTATTAACAGAATCTTCACTGGAGTT
GTTTCAGAGTCAAATAAGAGTGGAGTTATGGTTAAATTCCTCGATGGTCTAAAGAAGCTT
GTGATAATTAAGGATCTTGAGACTGTTTAAAACTTCTCTGAGATCTACAAACCAGGTAAA
GTTGTAAGAGTTGCTTTGAACAAGTTGAACAGATTATGTCTTAAGAATAATGTCATTTAT
TTGAACGATCAAACACTCATCCAAAAGGATAAGGAACTTCAAATCAGAAGTTTCTACAGT
GAAATAGAGACTCAATTAAAGGCTCATGAAATTAAAATTGGAGATAAGATTCAAGGAGAA
ATATCGCTTGTAAAAGACTACGGTCTTATTGTATCAGTTGAGAAGTATGAAGGACTTACA
GGATTTGTGTTGAGCGAGCACTAAGTAAGTGGAAGAACACACAAAGAAGGCTAGAAAATA
ACATGCATAGTTATGGACATTGATTTTGAGAAGGAAATCATAGATCTCAGTGAAAAACTT
GCTGAAAACACAAAGAGCAAAGACTCAAAGATTGCAAAAGGATCAAACCAGAAAGTTATA
GTTGAATTAAACAAAGAAGATTATCTCATAGTTAGTTTCAAGAACAACAAATCTCAATTT
GGATTGTTAATGGCTCAAACCTACAACAATGATCATTCTGAAAACCCAAATGAGAAATTC
ACAATCGGAGATGAACTTGATGTTTAAATCGTGGATCAGACAGAGACTGGATTCTTCCTT
ACTATTCCAGTGATTGTAGCCCCATCAAAGTCACAAGACAAAAATAAATAAGTGAGTACT
GTAAGCCTTGCCCAAGGAGTACTCGTCAATGCATAGATAAAGAGCAAAAAACATGACTGT
ATTTACCTCTAAATTCAATAACAAAGTCAGCTGTCTATTGGAAGACTACATAGAATTGAA
TGTCAAACTGACAATGAGTTTAAGAATTTCTAAGTAGGAGAAACAGTGTAAGCTAAAGTA
CTGAAGATCAGCTAAGGTGCTGATAAGAAGACTTTCATTGAACTGACAAGAAGAAAGGAA
CACATGAAAAAGACTTCAGGTCTAGATCAGACCACTCTTGAAAAAACTGTTTAATCAATG
GAAGAGTTAAAGAATGGTGTTACTTATGATGCTATTATCACTGATGTTAACTACTCTTTC
TCTCAACCAATCTAAATTAGTCTCTCCCCTTTCGTCAGAGGGCAAATTAGTTTTGATAGA
ATCATTAACTAAGAGACTCTTTAAAAAGAAGGTAGCTCAATTCTTCAAAAGTTCAGCCCT
GGAGCATAAATTAAAGTCGCCTATCATAATGGCCAATTCGGTATTGTAGATTAACAAGGC
AAAGGTAAACTTGTAAAGGGTCAAAAGGTACTAGCTAGATTTGTTAAAGAGGTTAAAGGC
AAGGGTATCACAGTTTAACTAAATGAAAAGACTTTTGGATTCATTGAAATTTCAGAGATC
TCCGATGATATCATTGGAAGAGTATGTGACCATTAACTACAAAACTCACCAATTTTTGTT
GCTAGAGTCATTAGTTTCGATAAGCATGATAAACCAGTATTATCAGCAAGAGAATCAATC
TTAGATGACTCCAAATGGGCACTTATTGGACCAGAGGGTAAATCTGCCCACTTCCTTAAA
TTTGATGAAAAGAATCAAAAGCTTGGAAACTAGAGAAACAAGATCTTGAAGTACACTGCT
GGTGTAGCCCTCCAGGAAGGTGATTTGTGTTTGGGTTATGTTACAAATATCAGTAAGAGC
GGTTGCTTCATTCAAGTTGGCTATTAATCAACAGTGAGATCTGGCTTAAATGAACTTAAT
GATGATAGTTCATTTGATTTCTAAGAAAACATGCCTCTTGGTAGATTAGTCTTATGCAGA
GTTGTTAAAGTAGACGAATCAAATGGTCAAAAGAGATTCAATGTTACACTCAGAAGATCC
CTTGTTGTTTATGGAACTAATGCAATTGAAAAGAACTCCCTCTAACCAGAAGCTTAAGTT
GAATGTATCGTAATGGCACTAGCTGATGGCAAGTTATTCGCTTAAGTTAAAGGTAGCTAC
CACAAACTTAAGATTAAGGGCACCTAAAAAGGTGTTAAAGTTGGTGATCATGTTATTGCT
TAACTTGAAAAAGTCTCTAAGTTAAAGATCACTGCAACTTTCGTTGAGAAAGTAAAGGGA
TCAGGCATGACTGAAGAAGAGAAGCAAGTCGACAAACTCTGGCAATTAGTTGAGGAAGAA
TCTTAAAAAGATATTGATGCACAAAGAGAGCAAGCTCATTAAGCTGAACACGATGCAACT
CTTATTAAGAACCTCGGTAATGCCCAAGATCAAATTGAGGAGTAGATTAAAGATTTGAAA
GAACTGTAAGTTGATGAAGATGAAGAAATGGAAGATGTACAAGGTGACGATAGTGACGAA
GAGGAGATGTAGAGAATCATTAAGCAAAGCAAAGTCTATGAAGATGAGGAAGAGAATGAC
GACGATGAAGATGAAGAGATGGAAGATTTAGATGATGAAGATGAAGACGTTGATATGGAT
GAAGACAGTGACGAAGAAGAATAAGACAACAAAAAGAAGTAAAGTGGCAAACAATCACTC
AAGCAGAGAGTAAAGGAAGAATAAGAAATCAGAAAGAAGGAAAAATCACTCAAGGACAAC
AAAGAGCAACCTAAGACAATCGAGGATTACGAGAGATTAATTGTCCAAAACAAGGATCAA
AGTTACGTTTGGATCTAATATATGGCATTCATGATAGATAAGCTTGGATTGGAATCTGCC
AGAAAGGTAGTTGAGCGTGCTGTTAAGAGCGTCTCCATTTCAAACGAAGAAGATAAGTTC
AATCTTTGGATTGCATATATGAACTTGGAGAACAACTTCGGCACTTAAGAAACCCTAGAA
AAAGTCATCAAGCGTGCCCTTGAAGTTAATGACAGAAAGCGTATATATTTGCAACTAATC
AGCATTTATCAAGCATCCCAAAAGTACCAATATATCGAGGAGATCTATAAGTCATTGTGC
AAGAAGTACAACACTTCTCTGAAGATATGGTCTGCTTACCTTGAATTCTTATTCACTATG
AGAGATCTGAAGAAAGACAAGAGCAACTTCTTAGTGAAAGAAGTGACAGTCGCTGAGCCT
AAGTAAGTTTTACAGAGAGCTCTGCAGTCATTGCCAAAGGATGAGCATGTTAATATCATA
AGCAAATACGGTTAATTGGAATTCAAGCACGGATAGCCAGAGAGCGGCAGAACTATGTTA
GAAGGTATTGTCACTAACTACCCAAAGAGAATGGACATCTGGGCAATCTACATGGATATG
GAATCTAAATACAGCGGAGAAAATAAGCAGCAAGCCCGTCACTTGTTCGAGCGTTGCCTA
ACCAACGAATAAATTTTGAAGAAGCCAAAGAAGATGAAGTTGGTGTTCCAGAAGTACATG
GAGTTCGAAATGAACCACGGCAACAAGAAGAACGTAGAGAAACTCAGAGAAAGAGTTGAA
CAGTATCTTGAGAATGCATTCGATAAAAAACAAAAGAAAGACAAGGATAGCGGAGATAGT
GATTCAGAATGA


>Contig5641.0.g70(protein)
MKTKAPKQQSQDFFPRSANNQKTKGFIFNQAPINKKLAQDELKQTMAQDVSEGKTHKTGK
KRSAFMAKLYEDEAIDDEMRVFDMEGDEDIVEKEVVEEEGKTSKRANKELSKKKGAKTHV
DKTSEVAANKINRLKFNVGSLGLFAISEIQTKYLIVNYTRNTKGYVSLEGLSHLADKFKI
GQFIIASVLSAGTSKYNTETSGNRNKKLQLTIQIDHLNKSLSAENLAPNMLLQGLVESKE
AKGHLINFGLKDKTKGFLPFTNDTQHLQIGSLVQVLIKTVLASSKVAKCEFINQSVEEYH
QYMNVKDITIHNLKPGFMVNSKVSKILDNGIELTFLGGFKGTIFTDHLDKSDPTKYKIGE
KIGARVIAVDPQAQNVQMSLLPHIKQMNDKVVYNTMKQSGVHVGQIIEKATVEKELYGGS
YKVKFGKDQIAFLHKSHTKEDVVPEEEEEEEEIPTQSKDKKQKVAKKSDELEVGQKLEKV
RVKEINYFDGLPILSIKEDILNSATLTYEDLKCGDYISTMVTEVNEDKKFVTLQVNDFVK
GRLYLEHMADFPMKVIPPKYKDLGKTLKMRVFNVDKKTRTLDFTRKDTLLKAKVPVYQSY
REVEKGSKLYGVIVGENEYGYVVKSFGGIKGLLTFADIKANSKGSKKDFSSLKFGSIVKA
YVLFKKKDQGMALTLDKSKAKELREEASKNGKDKKSKTQVTGQQNQDKFEDFLPTESEND
ALKDKYKTFMKVSQDKANIGKVQQFRVLEQTEKYLVCKSLEAVKKSQNYIAILPNILINK
HHQPSFTLEDFTFQAITLEVTSDSFPIISSQYDLIQLKDSIPRKNADISTDAINRIFTGV
VSESNKSGVMVKFLDGLKKLVIIKDLETVQNFSEIYKPGKVVRVALNKLNRLCLKNNVIY
LNDQTLIQKDKELQIRSFYSEIETQLKAHEIKIGDKIQGEISLVKDYGLIVSVEKYEGLT
GFVLSEHQVSGRTHKEGQKITCIVMDIDFEKEIIDLSEKLAENTKSKDSKIAKGSNQKVI
VELNKEDYLIVSFKNNKSQFGLLMAQTYNNDHSENPNEKFTIGDELDVQIVDQTETGFFL
TIPVIVAPSKSQDKNKQVSTVSLAQGVLVNAQIKSKKHDCIYLQIQQQSQLSIGRLHRIE
CQTDNEFKNFQVGETVQAKVLKISQGADKKTFIELTRRKEHMKKTSGLDQTTLEKTVQSM
EELKNGVTYDAIITDVNYSFSQPIQISLSPFVRGQISFDRIINQETLQKEGSSILQKFSP
GAQIKVAYHNGQFGIVDQQGKGKLVKGQKVLARFVKEVKGKGITVQLNEKTFGFIEISEI
SDDIIGRVCDHQLQNSPIFVARVISFDKHDKPVLSARESILDDSKWALIGPEGKSAHFLK
FDEKNQKLGNQRNKILKYTAGVALQEGDLCLGYVTNISKSGCFIQVGYQSTVRSGLNELN
DDSSFDFQENMPLGRLVLCRVVKVDESNGQKRFNVTLRRSLVVYGTNAIEKNSLQPEAQV
ECIVMALADGKLFAQVKGSYHKLKIKGTQKGVKVGDHVIAQLEKVSKLKITATFVEKVKG
SGMTEEEKQVDKLWQLVEEESQKDIDAQREQAHQAEHDATLIKNLGNAQDQIEEQIKDLK
ELQVDEDEEMEDVQGDDSDEEEMQRIIKQSKVYEDEEENDDDEDEEMEDLDDEDEDVDMD
EDSDEEEQDNKKKQSGKQSLKQRVKEEQEIRKKEKSLKDNKEQPKTIEDYERLIVQNKDQ
SYVWIQYMAFMIDKLGLESARKVVERAVKSVSISNEEDKFNLWIAYMNLENNFGTQETLE
KVIKRALEVNDRKRIYLQLISIYQASQKYQYIEEIYKSLCKKYNTSLKIWSAYLEFLFTM
RDLKKDKSNFLVKEVTVAEPKQVLQRALQSLPKDEHVNIISKYGQLEFKHGQPESGRTML
EGIVTNYPKRMDIWAIYMDMESKYSGENKQQARHLFERCLTNEQILKKPKKMKLVFQKYM
EFEMNHGNKKNVEKLRERVEQYLENAFDKKQKKDKDSGDSDSE