Identifiers and Description

Gene Model Identifier

Contig20005.0.g63

Standard Name

PCNA1c

Aliases

Contig20005_0_g63

Description

Proliferating cell nuclear antigen, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00705 ) Proliferating cell nuclear antigen, N-terminal domain
  • ( pfam02747 ) Proliferating cell nuclear antigen, C-terminal domain
  • ( pfam04139 ) Rad9
  • ( pfam02144 ) Repair protein Rad1/Rec1/Rad17
  • ( pfam04005 ) Hus1-like protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011074202.9999146385131704e-95proliferating cell nuclear ant
igen (pcna)
SGDYBR088C3.9998411574835458e-50POL30 SGDID:S000000292, Chr II
from 425766-424990, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20005.0.g63(coding)
ATGTTCGAAGCAAAACTAGCAGATGGCCAGACTTTAAAACGTATCGTAGAAGCAATCAAA
GACCTGGTGACTGATGTAAACATAGACGCCACTCCAACTGGACTTTCACTGCAAGCTATG
GATTCCTCTCATGTAGCCCTAGTCAACTTGCATCTATCAATGGAGGGATTCGAGAAATAC
AGATGTGATAGAAACTTGACACTGGGTATAAGCATAACTAACTTGGCTAAGGTTATGAAA
CTTGTTAATAGCAATGACTCAATCACTTTGAAGTGTGAGGATGAGCCTACATATCTAACT
ATAGTGTGCCTTAATCAGAAATTGGATAGAACAACTCAGTTCAACATAAACTTGATAACC
TTGGACAGTGAACATCTCGGTATCCCAGAGACTGAATACACTTCAGAAATTACTATGAAC
TCAAGTGAATTCTCTAAGCTATGTAGAGAGCTCTACGTACTCTCAGAAACTGTGGAATTT
GAAATCAGCAGCACTTATGTGAAATTCAGTGTAGAGGGGGAGGTAGGTTCTGGCAGCATT
AAAATTCAAACCGGCGGTGGCTTTGCTGGAGATGAGCAAGTGACTAAAGAAGAAGACACT
GTTAAGCTATCATTTGCATTGAGATACTTAAATCTGTTCAATAAAGCCTATACGTTGAGT
AGTCAGGTCAAACTTAGCATGGCTGCTGACACCCCGCTGGTAGTGGAATACGAGGTTGAG
ATGCTTGGTACACTCAAATACTATCTGGCTCCTAAAATCACTGATAGCGGCAATTGA


>Contig20005.0.g63(protein)
MFEAKLADGQTLKRIVEAIKDLVTDVNIDATPTGLSLQAMDSSHVALVNLHLSMEGFEKY
RCDRNLTLGISITNLAKVMKLVNSNDSITLKCEDEPTYLTIVCLNQKLDRTTQFNINLIT
LDSEHLGIPETEYTSEITMNSSEFSKLCRELYVLSETVEFEISSTYVKFSVEGEVGSGSI
KIQTGGGFAGDEQVTKEEDTVKLSFALRYLNLFNKAYTLSSQVKLSMAADTPLVVEYEVE
MLGTLKYYLAPKITDSGN