Identifiers and Description

Gene Model Identifier

Contig17516.0.g71

Standard Name

PCNA1b

Aliases

Contig17516_0_g71

Description

Serine carboxypeptidase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003469002.000043494209831e-96Serine carboxypeptidase family
protein
SGDYMR297W8.999119107228014e-72PRC1 SGDID:S000004912, Chr XII
I from 861922-863520, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17516.0.g71(coding)
ATGTTCGAAGCCACTTTGAAAGAAGCAGCAACCCTTAAGAAAATCATCGATGCAATTAAG
GACTTAGTCACAGATGTAAATATAGATGCCACACCATAGGGATTAAGTCTTCAAGCCATG
GACAGCTCTCATGTAGCCTTGGTATCTTTGACTATGGGACAACATGGATTTGAGAAATAC
AGAGCAGACAGAGCAATGACTTTAGGTATTTCAATCACAAATCTCGCCAAGGTACTCAAA
CTTGCCTCAAATGAAGACAAAGTTAGCTTGAGAGCAGATGAAGATGGGCAACACCTTTAG
ATCTCATTTACTAACTCAAAGCAAGAAAAATAAACCTAATTCAGTCTAAACTTGATAACC
TTAGACAGTGAACACTTAGGTATTCCAGAGACCAACTATACATCAGAGATTACTATGAAC
TCCTTCGATTTCTCCAAGCTTTGCAAAGAACTTCATTCCCTGAGTGAGACAGTAACAATC
GAAGCCAGTACTGACTATGTGCAATTCTCAATTGAGGGAGAAGTCGGTTCAGGAGTGATT
AAGATCAGCACAAACGACGGCAGCTCAGAAAAAGAAACAAAGCAAGATAAAGTTACACTC
TCATTCGCACTTAGATACTTGAACATGTTCAACAAAGCCTCTTCTCTTTGCAATTATGTT
AAACTTATGCTTGCTTGTGACACCCCTCTCGTTGTGGAATATGAAATAGAACATATGGGA
TCACTTAAGTACTATTTGGCTCCAAAGATCAATGAGAATGATGCAATTAAAGCCTAATGG
TAAGATCAGGGAAACGAAAATAAGACAGATAACACAACTGGTCTGCCTCCAAACTTCTAT
AAATTTGAGAATGATACTCTCTTGGTGGATCGTATCCCAGTCGATGACTAAGAGTCATTA
TTCTTTATGATGGCTATGTCAAGAAATGATCCTGAAAAAGATCCTTTAATTATATGGTTG
CAAGGAGGTCCAGGCTGCTCTTCATAAATTGGCATGTTCACAGAGAATGGACCCTATAAC
ATCAAATTCGATAGACTTAAGAATCCTTCTTATGAGATTCATCATAACTCTTACTCTTGG
AACAATATTGGAAATGTGATGTATCTAGACTAGCCTTTGGGCACTGGTTACAGTCAAATA
TTCCTTGTGGGTTTCCTTAATAAATATCCTTAATTCAAAAAGAGACCAATCTATCTGACA
GGAGAAAGTTATGCTGGGCATTATATCCCTGCCTTTGTAAAATTCCTTATGAAGATGGAA
AATCCAGATATTAATATTGCTGGAGTTGCTATCGGTAATGGTTGGGTTGACCCATTTTAT
CAATACCCTGCTTACAATACCTATGCTAAAGAAGAGGGCATGATTAACGGACCAAGATCT
TTCTTGATTCATGCAGGCATGAGTTTTTGCTAAGTAATGATGCTCATGGAAATGCCATTA
GTTTCAGCTTCTATATGTAACCTTGCTACTTATACAGTGATGGGAAACCCTATTTACCCA
GACTTTAACATTTACGATCATAGACTCAAATGCATAACTCCTCAGACCTGCTACCCAGAG
AATGGATTGAACTTTTATCTTCAGAGCAGAAAATTCAGGACATAATTGAAGGGTGTGCAA
TTTGGAAGTTGGTAAATGTGCGATAACTTCGTTCATCTTGCTCTTACAATGAACAATCAA
TGGAACTATGGAGCGTACTTGAAAGATTATCTCAATGCAAACATGCCTGTCCTGATCTAT
AGTGGAGACAAAGATTTTATCTGTAACTGGAGAGGTGGTGAAGCCTGGACTCAAGCTTTA
GTTTGGGATAAGCAAGATGAATTTAATGAACAAGTCTACAAAAATTGGTCTGGATCTACT
AATTTCGAAGACAGTACTGAGGTGGATGGACAGATCAAGAACTTTGAAAATTTCACATTC
TTTAGAATTTACAATGCAGGTCATATGGTACCTATGGACTAACCTGAAGTGGCATTGAAA
ATGATGTAGGAATTCATTAAGCATGGAAAATTACTCTCTATTGAAGAGCAAGTAAATGAC
GTGCCTCACAGTGATGATGAAATTCCAGATGATACAGATGTATAACCACCTAGTCCTACT
GAAGGACCTTAACCTACCGAAGCACCTTAACCCACTGAAGCTCCTTAACCTACTGAATAA
GATATAAATACTTAGTAATCTTGA


>Contig17516.0.g71(protein)
MFEATLKEAATLKKIIDAIKDLVTDVNIDATPQGLSLQAMDSSHVALVSLTMGQHGFEKY
RADRAMTLGISITNLAKVLKLASNEDKVSLRADEDGQHLQISFTNSKQEKQTQFSLNLIT
LDSEHLGIPETNYTSEITMNSFDFSKLCKELHSLSETVTIEASTDYVQFSIEGEVGSGVI
KISTNDGSSEKETKQDKVTLSFALRYLNMFNKASSLCNYVKLMLACDTPLVVEYEIEHMG
SLKYYLAPKINENDAIKAQWQDQGNENKTDNTTGLPPNFYKFENDTLLVDRIPVDDQESL
FFMMAMSRNDPEKDPLIIWLQGGPGCSSQIGMFTENGPYNIKFDRLKNPSYEIHHNSYSW
NNIGNVMYLDQPLGTGYSQIFLVGFLNKYPQFKKRPIYLTGESYAGHYIPAFVKFLMKME
NPDINIAGVAIGNGWVDPFYQYPAYNTYAKEEGMINGPRSFLIHAGMSFCQVMMLMEMPL
VSASICNLATYTVMGNPIYPDFNIYDHRLKCITPQTCYPENGLNFYLQSRKFRTQLKGVQ
FGSWQMCDNFVHLALTMNNQWNYGAYLKDYLNANMPVLIYSGDKDFICNWRGGEAWTQAL
VWDKQDEFNEQVYKNWSGSTNFEDSTEVDGQIKNFENFTFFRIYNAGHMVPMDQPEVALK
MMQEFIKHGKLLSIEEQVNDVPHSDDEIPDDTDVQPPSPTEGPQPTEAPQPTEAPQPTEQ
DINTQQS