Identifiers and Description

Gene Model Identifier

Contig12091.0.g3

Standard Name

PCNA1a

Aliases

Contig12091_0_g3

Description

Proliferating cell nuclear antigen, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011074208.003265703977305e-104proliferating cell nuclear ant
igen (pcna)
SGDYBR088C1.0004249259458435e-52POL30 SGDID:S000000292, Chr II
from 425766-424990, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12091.0.g3(coding)
ATGTTTGAAGCTAAACTTGCTGAAGGTCTCATCCTCAAGAAAATCGTCGAGTCCATCAAG
GATATTGTCACAGACGTCAACATTGATATCTCACCATCAGGCATCTCCCTCCAAGCTATG
GACTCCTCTCACGTTGCCCTCGTGTCACTCAACCTCTCCATGGACGGTTTCGAGCACTAC
CGTGCCGACACCAACATGGTCCTCGGTGTCTCCATCGCCAACTTGGCCAAGGTCATGAAA
CTTGCAGACAACAATGATCAAATCACTCTCCAAGCCGATCACGAAGCCACCCACTTGAAG
ATCATCTTCGAGAACCCAAAGACTGAGAGAACCACTGAGTTCAACTTGAACCTCATCACC
ATTGACAGTGAACATCTCGCCATCCCAGAGACTGAATACTCATCTGTCGTGACCATCAAC
TCAGGTGAATTCTCCAAGATCTGCAAAGAGCTTTTCTCTCTCTCAGAAACTGTTCAAATC
ACCACCAACCCAGAGTACGTTCAATTCTCCGTCGAAGGTGATGTTGGAAGTGGTTCAGTT
AAACTCGGACACAACGACTCAGACAAGAAGGAAGACCAGACTGTATTGGAAGTTAGCGAG
AGCGTACAACAACAATTCGCTTTGAGATACTTGAACATGTTCAACAAGGCAGCTACTTTG
AGCAGCTTCACTAGACTCTGCCTCCATCAAGAGCAACCCCTCGTTGTCGAGTTCAAGATT
GACAACCTCGGAGTGCTCAAGTACTTCCTTGCCCCCAAGATCAGTGACGAGTGA


>Contig12091.0.g3(protein)
MFEAKLAEGLILKKIVESIKDIVTDVNIDISPSGISLQAMDSSHVALVSLNLSMDGFEHY
RADTNMVLGVSIANLAKVMKLADNNDQITLQADHEATHLKIIFENPKTERTTEFNLNLIT
IDSEHLAIPETEYSSVVTINSGEFSKICKELFSLSETVQITTNPEYVQFSVEGDVGSGSV
KLGHNDSDKKEDQTVLEVSESVQQQFALRYLNMFNKAATLSSFTRLCLHQEQPLVVEFKI
DNLGVLKYFLAPKISDE