Identifiers and Description

Gene Model Identifier

Contig10935.0.g109

Standard Name

PAZD2

Aliases

Contig10935_0_g109

Description

Autophagy-related protein 13

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam10033 ) Autophagy-related protein 13
  • ( pfam12212 ) Piwi/Argonaute/Zwille siRNA-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10935.0.g109(coding)
ATGAAGAGACGACTCTTTAAGCGCTTTAAAGTTGGCGACACAAGTGCAAAGAATTTCTGG
AGATTTTGCATGAACATTGAAAATTAAAATGATATGAGACAACTTTTGTCAGCTTTTGGC
TCTCTTACTCCAAGCATGACTGAGCAACTTTTTTCACCAAATGAAACTGAGAGACCATTA
TTTTAGGACGTTTTTCTAGACGTGATTCATACGAACAGAATAGGCTCCGTGCTTTCTGAA
AGATGGAATTTCAGTCTTTCCTTGTCACCATAGACAAAGAAGTTGTCAAATCAGGCTTCA
GCAATCGAAAGCGGGAAATCAAGTTAACCGGGATATTATAAAAGACTGTGTGTCTTATTG
CGCTCAATTCGCTCTCTTTAATTAGCTCTTCCCACGTATAACTTAATTTAAAGACTCCAA
AAGATAGCCAAAAATTAGCTATTGCGAGCTCCTGATTAGGATGTATTAAAAGATATTCTA
AATGATATTAAGACTGAATATGAAATGAAGTATGACGCAGAGATGTTGGTTAATGAGTTT
TCAGAGAAGTCCCAAATTATCAATAGAAGAATTGGTTCTATTAAGAATTCATTTGGTGAA
CTGACAGTCGAAGTGTTTTACATAAAATAAAATGACATCATTGATAACTTTAAATGCCTG
ATGAAGTAAAGGGTAGAAAAATAAGCTTTAGCTACAAATAATCCATTTTAGTAGTTGCTA
ATGAATGCTCTCGGCCCAGGAGCTAATTCTGACAATACTTATAACTACTCTTTGGGTCAG
AGAGCTCTAAGGAATCATTACTTAAATGATCGCATGAACATGCATTCGCCAGGTCCTTCA
GATGGGATCATGATTAGGGAAGATTATTTTACAAATGAAAAATAAAAGTTCTTTTATCAG
ATCTCTAATAAATAGTCAGGCAATTCTTTTTCTTCGGGTTTATCAAATAAATCATCTGAG
CTCTTAAAATAAGGCACTCCTCCTTATATTCCACAAATAAACTACCAACCTACGACATAG
GGATCCTCAAGCATCTTAAAGTCTTCTTTAGAGGGTAATGGTGGGTTTGGTAACTTTGAT
TCCCATGATTTTCAATCTAATAGACCTTCAAAACCAAAGATAGAGCCATTCAAAAAGTTT
GAAAACTTGTAATCTGCAAGAAATCGAAATTATCGCCTGTCTTTTGATGAAGGGTCTAAA
CAATTACAAAGTTAACGCTCTTTCACATCCTTATTCACACCTTCTAGTATCTAAAACCCT
AGCTCCTTTAGGAAGGCATCCAATATCAATGACGGTGGAAACTACTAGATTTAACATTAG
CAGATAGAAGAGGAAGACATGAATGATTACCAATTTGATAACCCAAGAAACCCATTCGCT
AAAAAGTTTCTTAAAGACGATAACGCTCATAGTTTTGAGAAATCAGGATTTAACCAGCTT
AACAAAAATAACTCTAACTCCTCTTTACAAGGCTATGAGGGTGCTGCTTATCCCAATAAA
TTAGGAAGTCCCTCTTCCAACCATTAATTTTTGCACGCTATACCACGAAAGAATTCAATA
ATATTCAAGAACGAGCAAGAAGGAACAGGCAGAATATCTTTTGGAGGGCACGGTCATGAG
CCAATTAAGCGCATTTCTAGTTGTCAAGACATGTTTATGCTGGGTGCTAATGCCTTAATA
CTTCAATAAGACCCCTTATTTTAGATTGATGAAAAGAAAAAGTACATTGGCTTCTTGGAA
GAGAGTGACGAAGAGAAAAGTTAAAGCGATGACTTGATGAGCTTAAGCAGCGAAGAGGAT
GAAGAGGAGACTTTACTTAAATTTGCTGAAAAGATTGGAAAGTATCAGAAATTGCTACAA
AAGGAAAATTCTTAACAGGTATCAGAAGTCGTTCAGGATAACGGAGAATTCTAGACTGAG
ATGAGAAGAGAACTTTTCCATTTGCTTCAATTTCGGGAAATTATTCTTGACAATAACCGT
CTCAAGATTAAATAACAAATACCCTTAAAATTTGGGCAATAGAAGGTTAAGAAATGA


>Contig10935.0.g109(protein)
MKRRLFKRFKVGDTSAKNFWRFCMNIENQNDMRQLLSAFGSLTPSMTEQLFSPNETERPL
FQDVFLDVIHTNRIGSVLSERWNFSLSLSPQTKKLSNQASAIESGKSSQPGYYKRLCVLL
RSIRSLQLALPTYNLIQRLQKIAKNQLLRAPDQDVLKDILNDIKTEYEMKYDAEMLVNEF
SEKSQIINRRIGSIKNSFGELTVEVFYIKQNDIIDNFKCLMKQRVEKQALATNNPFQQLL
MNALGPGANSDNTYNYSLGQRALRNHYLNDRMNMHSPGPSDGIMIREDYFTNEKQKFFYQ
ISNKQSGNSFSSGLSNKSSELLKQGTPPYIPQINYQPTTQGSSSILKSSLEGNGGFGNFD
SHDFQSNRPSKPKIEPFKKFENLQSARNRNYRLSFDEGSKQLQSQRSFTSLFTPSSIQNP
SSFRKASNINDGGNYQIQHQQIEEEDMNDYQFDNPRNPFAKKFLKDDNAHSFEKSGFNQL
NKNNSNSSLQGYEGAAYPNKLGSPSSNHQFLHAIPRKNSIIFKNEQEGTGRISFGGHGHE
PIKRISSCQDMFMLGANALILQQDPLFQIDEKKKYIGFLEESDEEKSQSDDLMSLSSEED
EEETLLKFAEKIGKYQKLLQKENSQQVSEVVQDNGEFQTEMRRELFHLLQFREIILDNNR
LKIKQQIPLKFGQQKVKK