Identifiers and Description

Gene Model Identifier

Contig16316.0.g26

Standard Name

PARP3d

Aliases

Contig16316_0_g26

Description

MORN repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002454900.000000000029994712494008525hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16316.0.g26(coding)
ATGTACAAATCTACTTCCAATTTGAGTTGCAGGATTAGAGGTTGTGTTTAAAACCACAAT
AATCACAACTGCTCTCTTTGCAAATGTTCCAACTCTGATCATCTATCCAGGAACTGCCCA
GAAGCTATGCATTTATATCATGGCACTACTCTCAGCAATTTTATTCAAATGTGCAATGAT
TAGTACAAGAACTATGTGCATATTTAGCCGAGCTTATCTGGATAAATGGGGTCAGGAATA
TACTTTACTACATTAGTTGAAGCAATCAAAATTGCAGATTTTAGAGCTTAAGGCCTTGAT
GGAGCAGTGGTAATAAAAGTGGCTGTGAATCTTGGNAAATTAAAAAAGTATTCTGATATG
GAGCGTGTTTCGCATTGTAATATTTCTGAATGGTCTTTCCTTAATTTTGATTCAGCAACT
TCAATACACCAAAGCTGGGCAGGCATTGACTATCCTTTCAGAGATTGGGTAGTAAAGAAT
AGTAATAATTTGAGAGTAACAGATGTTTGGTTAATGAGTGGAAGACTAAAATAGAATTTG
ACAGTTCCTAATGCTAATGTTTACTTAATGCCCAAATTTTAATAAAATTATCAAATCATA
AAAGCACAATCTGTAGTAAACTTATCCAGAAGTGAAGAATTATTTAGTGTGGTTAATCAT
TTGAATGTCTCAAGTCTAGGCGGTGTAATAAGGCAATGTCAAAATCCATAAGTGAAGTTA
ATTCGAGTTTAAGATCTTGACATATACGATGGGGAAAATATATCGGAAAAAGGTTGGGTT
GAAATGAGATTTACGGGATATTTATACGAAGGATCAAAAATATTTCACAAAGAAGGCAAC
TTGCATATCTATAACTACCGTGACAAATTAGAAACAAGCTACTAGGGAGAGTTTAAGGAT
GGCTTATATCATGGAAAAGGAACTCTAAAATTTAATGATCTTGAATACGAGGGTTTATTT
GAAGATGGGGTATACATTGGAAGAATGAATTATGTGGTACAATCCCCAAGGTTAGATAAA
AAAGTATATAGAACAATTTTTTATCCAAATGGTGACCGATACGAAGGAGAATAAGAGAAT
AATTTGCCTCACGGGTATGGAATATTCCATTACAGTAATGGATCAGTATTTGTTGGATTA
TTTAATGAGGGCATAAGACTCAGCTATGGAAATTATTTTACCAAGGAAAACTAAAACCCA
ATGATAACTGAAACTTTAAAATAACATAAGCTAGCCATTGAACCTCAAACCTTTAACCAT
TTTTATAATAAAACTTAAAATGGAGCATATTCCCCAAGATACAATGACCGGTAGGCCAAT
ATATATCCTTCTCGATATTAATCGAAAGGTCAAGAAACTAGTTATTATAATAGATATAGG
AGTGAATTTGCAAAAACATAATATAAATTTGAAGAGTTGATGCTAAGTTCTTGTCGTAAA
TATTGA


>Contig16316.0.g26(protein)
MYKSTSNLSCRIRGCVQNHNNHNCSLCKCSNSDHLSRNCPEAMHLYHGTTLSNFIQMCND
QYKNYVHIQPSLSGQMGSGIYFTTLVEAIKIADFRAQGLDGAVVIKVAVNLXKLKKYSDM
ERVSHCNISEWSFLNFDSATSIHQSWAGIDYPFRDWVVKNSNNLRVTDVWLMSGRLKQNL
TVPNANVYLMPKFQQNYQIIKAQSVVNLSRSEELFSVVNHLNVSSLGGVIRQCQNPQVKL
IRVQDLDIYDGENISEKGWVEMRFTGYLYEGSKIFHKEGNLHIYNYRDKLETSYQGEFKD
GLYHGKGTLKFNDLEYEGLFEDGVYIGRMNYVVQSPRLDKKVYRTIFYPNGDRYEGEQEN
NLPHGYGIFHYSNGSVFVGLFNEGIRLSYGNYFTKENQNPMITETLKQHKLAIEPQTFNH
FYNKTQNGAYSPRYNDRQANIYPSRYQSKGQETSYYNRYRSEFAKTQYKFEELMLSSCRK
Y