Identifiers and Description

Gene Model Identifier

Contig4017.0.g88

Standard Name

PARP3b

Aliases

Contig4017_0_g88

Description

Poly(ADP-ribose) polymerase catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4017.0.g88(coding)
ATGTAAAGGTCTAAACAATAATATACTTGCATTGCTAAGGGGTGTGCTAAAAACCACAAC
ACTCATTACTGCTCCTTTTGTAAATGTTCTAATGCAAACCATCTATCCAGAAATTGCCCA
ACAGCAAGGCACTTGTACCATGGAACTACACTCTAGAACTTTATTCAAATGTGCAATGAA
TAGGGATGCAATTATGTAAATCTTAAGCCAAGCGAATACGGAAATATGGGTCCAGGAATA
TACTTGACTACATTAGTTGAAGCAATTAAAATAGCAGATTATAAGGCTGATGGTCATGGA
GCAGTGGTTATAAAAGTGGCTGTGAATCTTGGAAAACTAAAATAGTGCTCTGATCTGTAG
CCATCTCCATATTTTGACATCGAAGAATTTACCGAACAAAAATTTGATTCAGCAACATCA
ATACACGAAAGATGGGCAGATATAGACTATCCGTTTAGATAGTGGGTTGTGAGACATAGC
AATAAATTGAGAGTTACTGATGCATGGTTACTGAATGGAACTCTAAATAGCAAGTTGACG
GTTCCTAATGCTAATGTTTATATAATGCCAAGTTTTTAGATAAAAAATCAAACAATTAAA
GCTCCTTCTTTTGTAAAATTACCAAAAAGATAAGGTATTTTTAGTTCACTTGATCACAAG
AACGTCTCCAGTCTTGGTGGTGTAATTAGTGAGTGCCAAGATCCTGAAGCTAGCTTTATC
TCAGTTTTACGTCAAAACATGGATTTATATGAGCAAGTCGGATATAGAGTGATATTTTCT
GGTTATCTATACGAAGGTACAAAGATATTTCATAAAGAAGGAATATTATCACACTTTGAT
AATGATAGCAATGAAGTTCTAAGATATCAAGGAGGCTTTTATGATGGATACTATCATGGA
AAAGGCTTATTAAAGTAAAATGGTTGTGAGTTTTTGGGAACGTTTAAGCACGGGGAACTA
GATGGAAGTTTAAACTCGAAAATTAAAATACTAAATAGAGAAGCAATATTCTATGCTGGT
CATGAAAATGAAAACGAATGGTTCAAGCATGGTAAGCATAAATCAATTAATTGTAAAATC
ATAAATTAGGGACAATTTATTATTCAAATGGTGATCGATATGAGGGTGAATTTGTTAATC
ACTTGCCGTACGGGAAGGGAAAGTACATTTACAAAGATAGGTCAATTTAAGTTGGAAAAT
TAAATGAGAGGAAAATGCAAAGCAGTGTGA


>Contig4017.0.g88(protein)
MQRSKQQYTCIAKGCAKNHNTHYCSFCKCSNANHLSRNCPTARHLYHGTTLQNFIQMCNE
QGCNYVNLKPSEYGNMGPGIYLTTLVEAIKIADYKADGHGAVVIKVAVNLGKLKQCSDLQ
PSPYFDIEEFTEQKFDSATSIHERWADIDYPFRQWVVRHSNKLRVTDAWLLNGTLNSKLT
VPNANVYIMPSFQIKNQTIKAPSFVKLPKRQGIFSSLDHKNVSSLGGVISECQDPEASFI
SVLRQNMDLYEQVGYRVIFSGYLYEGTKIFHKEGILSHFDNDSNEVLRYQGGFYDGYYHG
KGLLKQNGCEFLGTFKHGELDGSLNSKIKILNREAIFYAGHENENEWFKHGKHKSINCKI
INQGQFIIQMVIDMRVNLLITCRTGRESTFTKIGQFKLENQMRGKCKAV