Identifiers and Description

Gene Model Identifier

Contig9949.0.g80

Standard Name

PARP3a

Aliases

Contig9949_0_g80

Description

Poly(ADP-ribose) polymerase catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00644 ) Poly(ADP-ribose) polymerase catalytic domain
  • ( pfam09177 ) Syntaxin 6, N-terminal
  • ( pfam09954 ) Uncharacterized protein conserved in bacteria (DUF2188)

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9949.0.g80(coding)
ATGGATAATTCTAGTCTTTACGATAAATGCAAAGTCATTCTATGCTAGCATATTCATAAA
AAACATTATTGCAAGATTTGTTGTAACACTGATTCAAATCATTTTTCTAAATATTGTCCA
AAGGGTACAATTTTATGGCATGGTACTAAGCTAGAAAACATTGAATCTATTTTAGAAAAT
GGTTTCTATTAGAGTCGTGAAGGGTCTATGGGAGCTGGAATTTATCTGACCACAAAAGAA
GAAGCTCTCAGCATTGCTAAGCATAGAGGAAATTAAAATCAATCAAAGTATGTTGTGATT
TAGGTTCGAGTCAACCTCGGCAAAATTCTTGAATTAAAAGAGAATCATGATTTTGAAGGC
AAATGGAGAGAAAATCAATTTAATAGTGCAACAAGATTTCATTTCTCTTGGGCAGGTATT
AAAACGAAATTTTAAGAGTGGATAGTGAAAGACAATTCATAGCTTTAAATTATGGGATAT
TTTGAAGAAGATGGCTCATATTTTGAAGTATATAGAGACTATAAACAAAGAAAATATCAA
GGATTCAAAATGTAGAAGAAAGAGTATTTTATCATACAGCAAAAAAACAGTATTCAGGAA
TTAGTTTAACTTAAAAAAGAGATTGAGTATAAAATTTAAGGCTGTCATGAAATTATAGAG
ATCATAGAAAAAGATATAAAATTTCTTGATAAGATGATCAAAATGGTAGACCGTAGTGAT
CTATTAGGTAGCTTATCTGATTAGCATTTGTAGAAAAGATATGATAAAAAAGAAAAGGAA
ATCTAATTATAATAATTAAAAATTGAAATTTCAGTTATTAATGAAAAAATAACTTCTCTA
TAGTAATAATTAATGTGA


>Contig9949.0.g80(protein)
MDNSSLYDKCKVILCQHIHKKHYCKICCNTDSNHFSKYCPKGTILWHGTKLENIESILEN
GFYQSREGSMGAGIYLTTKEEALSIAKHRGNQNQSKYVVIQVRVNLGKILELKENHDFEG
KWRENQFNSATRFHFSWAGIKTKFQEWIVKDNSQLQIMGYFEEDGSYFEVYRDYKQRKYQ
GFKMQKKEYFIIQQKNSIQELVQLKKEIEYKIQGCHEIIEIIEKDIKFLDKMIKMVDRSD
LLGSLSDQHLQKRYDKKEKEIQLQQLKIEISVINEKITSLQQQLM