Identifiers and Description

Gene Model Identifier

Contig12012.0.g59

Standard Name

PARP2a

Aliases

Contig12012_0_g59

Description

Poly(ADP-ribose) polymerase catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00644 ) Poly(ADP-ribose) polymerase catalytic domain
  • ( pfam02877 ) Poly(ADP-ribose) polymerase, regulatory domain
  • ( pfam05406 ) WGR domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007264705.998499168798168e-100WGR domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12012.0.g59(coding)
ATGTAAAAGAAAAGAGTCGCTAAAGCTGATGCTAAGAAACAGACTGCAGATGCCAAAACT
ACTAAGAAAGATATTATAACAGTCTCAACTTCTTCTTCTAAGGGAGGGATCTTGGTTGAT
CATAAAGTCCCTAATGCTCCAAGTTACACTGTTCTCTCTGCTGGAGATAAACCCCTATCT
TGCTATCTTATGTGGAGTGACATTAAAGATAATCACAACAAATATTACATCGCTTAAGGG
CTTGTAAGCAGTTCAGGTTAGCACTACCTTTGGACAAGATACGGACGTGTAGGCCTTGAT
GGTGTTGGTACTAACTAGCCATGCTCCTCGCTTGATACTTTGACAGCTTTATACAACAAG
AAATATAGAGAAAAGACAAATAAAGGATATACTGAGGTCAAAATGGCTCTTGGAAATCCA
AATTCAACTGTTGAAGGAGAATTCAAAAAAATAGAGCCTAAGAAAGCAGATGAATCTAAA
CTTCCAAAATCTAAGCTAGATGCTAAAGTTTAAGAGCTTATCTCTTTCATCTTTGATATG
AACTTGATCGAGTAATCAATTGTATAGATTGGTTATGATGTTAAGAGATTACCTCTTGGT
CAACTTGACAAAGAAACCGTACTTGAGGGCTACAAATATTTAACAGAAATTGAAAAAGTT
TTGAATGGCAAATCTAAAGGAGATCTTGCAGATCTTTCAGCCAAATTTTACACATATATT
CCTCATAACTTTGGTATGAAGCATATGAGCAATTTTACAATCAAAACTCATGAAATCCTC
AAGCAAAAGATTGATCTCATTCAAAACTTGATAGATATTAAAGTCGCTCATAAAATTGTT
AACCCTAAAAAACCTAAGAAATAAACTTCAAACCCTCTTGACGAGAAGTATGATGCACTT
AATTGTAAATTAGTTACAGTTAAAGAAGATTCTGAAGATAGAAAGATGGTTGAATAATAT
TTAGAAAACTCAAAAGACAGTCGCAGACTTAAGCTCCTTGATTTATTCGAAGTGTTTAGA
AATGGAGAAGACAAAACTTACAACCCATAAAAGCTAGGAACTAAGAAACTTCTCTGGCAT
GGAAGTAGATTCTCAAACTTTGGTGGTATTTTGAGTCAAGGTTTAAGAATTGCTCCACCT
GAAGCTCCTAAGACTGGTTATCTATTTGGTAAAGGTGCTTACTTTGCAGATATGGCTGGC
AAGTCAGCTCCTTACTGTTGTGCTGATCTATCTAAGAACATTGGTCTTTTCCTACTATGT
GAGGTAGCTCTAGGAAATCCTCGTTAACTCTATCAAACTGATTGCGATGCAGATAATCTG
CCAAACGGATTCCACTCAACTCATGGTGTGGGAACTAAACTTCCAAATCCAAAAGAAGCA
ATAAAGATTGATAAAGATATTGAGGTACCATTCGGCAAGAGTATAGCCAATCCAGACAAG
CAAGCTAACAGAAGCCACAACGAGTATATTGTTTACAATACAAACCAAGTTAAAATGAGA
TATCTCTGCAAAGTTCAATTTAACTGA


>Contig12012.0.g59(protein)
MQKKRVAKADAKKQTADAKTTKKDIITVSTSSSKGGILVDHKVPNAPSYTVLSAGDKPLS
CYLMWSDIKDNHNKYYIAQGLVSSSGQHYLWTRYGRVGLDGVGTNQPCSSLDTLTALYNK
KYREKTNKGYTEVKMALGNPNSTVEGEFKKIEPKKADESKLPKSKLDAKVQELISFIFDM
NLIEQSIVQIGYDVKRLPLGQLDKETVLEGYKYLTEIEKVLNGKSKGDLADLSAKFYTYI
PHNFGMKHMSNFTIKTHEILKQKIDLIQNLIDIKVAHKIVNPKKPKKQTSNPLDEKYDAL
NCKLVTVKEDSEDRKMVEQYLENSKDSRRLKLLDLFEVFRNGEDKTYNPQKLGTKKLLWH
GSRFSNFGGILSQGLRIAPPEAPKTGYLFGKGAYFADMAGKSAPYCCADLSKNIGLFLLC
EVALGNPRQLYQTDCDADNLPNGFHSTHGVGTKLPNPKEAIKIDKDIEVPFGKSIANPDK
QANRSHNEYIVYNTNQVKMRYLCKVQFN