Identifiers and Description

Gene Model Identifier

Contig16914.0.g87

Standard Name

PARP1h

Aliases

Contig16914_0_g87

Description

Poly(ADP-ribose) polymerase catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00644 ) Poly(ADP-ribose) polymerase catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008219209.002093297142233e-23hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16914.0.g87(coding)
ATGTAGGACAACTAACTCAAAGCCTAATTAGAAGAGGCTAATGTTTCGTTTCCTTCAAAT
CACGATGAAAAGGAAATAAATGTTCCTTTAATCTCTGGATAGCAAGTTGAGGAAGAAGAG
AAGGAGAGTTTCCCAAGCAATCCTACAATGAACTTCAAATTCATTCGAGAACAGTAGATG
CAAGCTGTTGTGTAAATGGCTCCAAAACAACTAGATGAATCTGATATGAGTATTGAAGCA
TATTCATGGGATTGTAAAGAGGTCTTGAAATTTATGTTCAACTTAGAGGCTTCTTTCAAA
TCTTTATGTTAAGACTATCCAAAAGTTCTAGTGAACTACAACCTTGACTAAAATGATCAA
GTATACTATGAGTTAAATACTATCCACGAGGATTTCAACTAGGTTCTTATTAAAATTGAA
GATTTAAAGATAATAAAGGAATGCTACATCCTCTAATATGCCTTCGAATGCGAAAATGAA
ATCTTGAAATATGAGTTCAATGACCTATTCCCCCAATATCAATTCGAAATTTCCCAAATT
TGGCTTGAACCTGAAACCATCTAAAAAGATTCCTCACAGATTGAAGTTAACTTCGTTTTC
GAAAAAATCAATGAACCCAAGCTTTAACAGCAGATAAACTTCTACGCGAAAAAGTTAAAT
GAGAGGTCTTTGTACTAAATATTATCAGATTTCAAGGAATTTCGAATCAGAAATTATCGA
AGAGAGTACAAATTTGATTTTAACGACTTTATCAAAGAGCCAGTTCTGAGAGAAATCTAA
TACAATTTCTTTCAAGAATCGAAAAAAGTTAAAAGTATCATTAATGCTAATGAATTAGAA
GACAAAGTTGAATTTACATATTACTAACTCATAATCTAAGATGTCTCTCTTGACTAGATT
AATGATCTGCAAACGCAATTTGAATAATTCCTTGGAAGGATCACAATATCTAGGCAAGAT
ATATGTAGCAAAGTCATTTTGGATGAAACTCTCTACAGCAAAGATAGAACTATTAAGGAT
AAAGTTGAAAATAAATTAGATGTTAAAATCTATAGAAACAAAGAGTTTTTTGAGGAGCAT
AAGCTCAATAAAGACAAGTTACTATTATACGATCTCTACAACCCTAACATCAATAAGATA
GTAAGATTTGAAGATGAGGAGTAGTTCCTTAAGAACAACAAGCAAAAAATTGAATATATC
ATAGTGGGAGAGATTGAGAAGCCAAAGTTTAATACTCTAAAAGAGAGATTCGATACTGAG
TTACAAACTGAAATTTTACCCTTATTAAAAGATTGCTGCGTTTTAACAGACTTTATGGAC
ATTTCATACATTAGATTTGATTTTATCAAACTGAAGTAATACAACAAGCAGCATGAAGAG
ACAATAAACTAAATCAATGCTTTTAATGATGAATTCATAGATGCAGCTAGACAAATGAGA
TTTGAAGTCACGGTATTAATACCTAATCCAGACTATGTTGGAGAGCAGATATTTGAAATA
TCTCATAGAAACCAAGTTACAATTGAAATCATGGAAAATCCACTACAAGAGCTACAGAAA
AGAATGACTAAGTTTGCGATTATGGGCGATACAAAGTAAAGAGAGAAAGCATTTTTGGAG
TTAAAAGAATTGGAAAGGGATTTGTAAAGGTAAACGGTTTAGGAAAATATTAATGATCAC
AGATTGGTATGGTCCATCAAAATGCTCACAGTCAACTACTTACACGACAAGCATTCAATC
AGATTTACAAAGAATCAGACAAATTTGGAAGAGTAGTAATTTGACAAATTGTTAAAGGAA
ATGGAGAAAATTCACATTAAGAGCTAGAAAAGCATTTTAAAATGCTAATGGTAGTTCAAA
ACATTTGAGAAAGATGGAGATCGATACACAAATAGGGAAGACAAAAAGAATGATTTCGTT
GATTATGAAGATGCAGTCTCCAAACAAATTGAAGAGCACTTTCAATATTGCCTAAGAAGC
GGTAACTTTGGACCAGCAATTAAGCTTAACATTTCTAATCATACTTATGAAATTTGGGGT
TCTAGCTTTTTGCCCTCTAATTGGTACTAGAAAAATATAAGCTCTTTATATGTCAGATAA
TTAAACAGAGTGGTCACAGAGATATTTGAATTTAACAAGAGTGAAGCTGAGTAGCAACTG
CTAACATAACCTGAATTCTAGGCTAGAGCTCAACTAGGGCTATACACTGTTGAAGGCAGA
CCAGATGATATGGCAAATTTAATGAAGGAATTGCTAAGCTACTACGAATGCTCAGAGAAC
CATTATCATACGTTACCTGTGAAGAAATATCTCAAAAATTGGGATATAGAATTTGAAAAA
GAGCTTGTGATATTATTCAAAGAAAAATACAATCTCAGACTTGAATTCTTGTATGATGAG
TTAGAAGCCAAGATTTATGGGATTAAGAGTAAAAAAGGCAAGAAAAAATTGGAAAAGATT
TTAGAGTAACAGAAACTTCACTAATTTCCATACAAATGGGATGCTATTGTCAAAATGATA
GTTTCACCTGCTCACTCATGGGTACACTAAGTAGACAAAGCATCATAGGAGTACAAATCA
GTGGTATCCTAGTTCTTTGCTTCTGGCTTAAAATGTAGAATATCATCAATCATGCGGGTA
TAGAATAAGAATCATTGGATTAGATACTAGCAAGAGAAAAATAGACTTAGTGAGAAACTT
TAGGATTTACAGCCAACAGAAAAGCTTTTGTTTCATGGTACCAGTAATACAGACTACATG
CAAATACTTGACAGTGAAGATGGCTTTGATACTAGATTTTCAAAGGCTGGAATGTGGGGT
TACGGCATCTACTTGGCAACATAGAGTCACTACGTTGATACTAGAGGCTATGTTTAGAAG
AAAGGTCATATAAAGACTATGTTTCTGTTGAGAGCATTAGTCGGAGAAGCCAAAAATCTA
GAGCCTGATAACACCTTGAAGATGCCACCTCTAATTCCAGGATCACAAACTAAGAGATAT
GATAGTGTCACAGGCATGACTTACGGTTGTCAGGTATATGTTATCTACTCCAATGGCAGA
GTCTATCCAGAATACATCATTAATTATTTTGACTATTGA


>Contig16914.0.g87(protein)
MQDNQLKAQLEEANVSFPSNHDEKEINVPLISGQQVEEEEKESFPSNPTMNFKFIREQQM
QAVVQMAPKQLDESDMSIEAYSWDCKEVLKFMFNLEASFKSLCQDYPKVLVNYNLDQNDQ
VYYELNTIHEDFNQVLIKIEDLKIIKECYILQYAFECENEILKYEFNDLFPQYQFEISQI
WLEPETIQKDSSQIEVNFVFEKINEPKLQQQINFYAKKLNERSLYQILSDFKEFRIRNYR
REYKFDFNDFIKEPVLREIQYNFFQESKKVKSIINANELEDKVEFTYYQLIIQDVSLDQI
NDLQTQFEQFLGRITISRQDICSKVILDETLYSKDRTIKDKVENKLDVKIYRNKEFFEEH
KLNKDKLLLYDLYNPNINKIVRFEDEEQFLKNNKQKIEYIIVGEIEKPKFNTLKERFDTE
LQTEILPLLKDCCVLTDFMDISYIRFDFIKLKQYNKQHEETINQINAFNDEFIDAARQMR
FEVTVLIPNPDYVGEQIFEISHRNQVTIEIMENPLQELQKRMTKFAIMGDTKQREKAFLE
LKELERDLQRQTVQENINDHRLVWSIKMLTVNYLHDKHSIRFTKNQTNLEEQQFDKLLKE
MEKIHIKSQKSILKCQWQFKTFEKDGDRYTNREDKKNDFVDYEDAVSKQIEEHFQYCLRS
GNFGPAIKLNISNHTYEIWGSSFLPSNWYQKNISSLYVRQLNRVVTEIFEFNKSEAEQQL
LTQPEFQARAQLGLYTVEGRPDDMANLMKELLSYYECSENHYHTLPVKKYLKNWDIEFEK
ELVILFKEKYNLRLEFLYDELEAKIYGIKSKKGKKKLEKILEQQKLHQFPYKWDAIVKMI
VSPAHSWVHQVDKASQEYKSVVSQFFASGLKCRISSIMRVQNKNHWIRYQQEKNRLSEKL
QDLQPTEKLLFHGTSNTDYMQILDSEDGFDTRFSKAGMWGYGIYLATQSHYVDTRGYVQK
KGHIKTMFLLRALVGEAKNLEPDNTLKMPPLIPGSQTKRYDSVTGMTYGCQVYVIYSNGR
VYPEYIINYFDY