Identifiers and Description

Gene Model Identifier

Contig4378.0.g77

Standard Name

PARP1g

Aliases

Contig4378_0_g77

Description

Poly(ADP-ribose) polymerase catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00644 ) Poly(ADP-ribose) polymerase catalytic domain
  • ( pfam12266 ) Protein of unknown function (DUF3613)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004617502.999534586690157e-23hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4378.0.g77(coding)
ATGCTAGCTGAAAATAGAACCATTAAATAGCATTTTACCAATAATGGAGTTTCATATTCT
ATCACTTTTAAACACAATAACCCAGTTCCACAAGGAATCATAAGTGGCCCTAATCCATTT
ACAGTATTGAGATGTTTCTCAAAAGGTAGAGTTTAAAAGCAATAAAGTCTAGAGTTGCCA
AAATCAAAAGTTATCAAAATTGAAAAGATAATGAACAAGTAATTGTATGAGAGGTTCGCT
ATCGAAATTAAGTTTATGAGTGAGAAGTATCCACAAAAAGATTTTGAAGATATAATGCAG
CATCTATTTCATGGATCTTATTTAGTAAACCCTTCACAAATCTATGATGACAGCAGCATT
GGATTTGATTTCAGATTATCAAATGATAAATGTTTATATGGAAGAGGAGCTTATTTTGCG
AAAAACTCTGGATACTCAGATTCTTATAGATACAAAATTCCTAATTCTTTTCAATATTAA
ATATTTGTTGCTCTTGTTTTAACTGGAAATAGTGTCACCTTAAACAAAACTGAGCCTGAT
CTAAGAGCTCCACCCTATAAACCTGGTAGTAAAATTTGGAGATTTGACTCCGTTCATAAT
GGATTGCAAGACCATTATATAGTTTATGATCACTATAAAGCTTACCCAGGCTATCTTATC
ACATATGAGGCCATTTGA


>Contig4378.0.g77(protein)
MLAENRTIKQHFTNNGVSYSITFKHNNPVPQGIISGPNPFTVLRCFSKGRVQKQQSLELP
KSKVIKIEKIMNKQLYERFAIEIKFMSEKYPQKDFEDIMQHLFHGSYLVNPSQIYDDSSI
GFDFRLSNDKCLYGRGAYFAKNSGYSDSYRYKIPNSFQYQIFVALVLTGNSVTLNKTEPD
LRAPPYKPGSKIWRFDSVHNGLQDHYIVYDHYKAYPGYLITYEAI