Identifiers and Description

Gene Model Identifier

Contig7116.0.g1

Standard Name

PARP1e

Aliases

Contig7116_0_g1

Description

Poly(ADP-ribose) polymerase catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00644 ) Poly(ADP-ribose) polymerase catalytic domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004617501.9994498063102785e-22hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7116.0.g1(coding)
ATGTTCTCATAAATGAAGTCAATTGAAACTGAGTACAAAGATGAACTGCTGAGCTTAGAT
ATTTTTGAATATAATGTTTAAGAATTTGGGCAAAGTTATATAGATGATTTCTACATAGAC
ACCAAGCAATAATTCGAATAAATCTTTAAATTACAGAATTAAATGAGCAAGGATATTGAA
CTTACAAAATTATTTGCGCAATTTTCTGACTTAATGGGTCCAGCGAATTTATCTTTTGCC
AAGATAAGTAATAGATTGATGGAGCTAAAGAATGTAATTCTTTCTTACTTCTCATGCAAT
TAGAGAGGCTCTAGCTTAAGGAAATATGTCTTATCATATCCATCATGTTTCGACACACTT
AAAATCATAAAACTCACACATCTCTACCTAGAAAATGCAGATTAAGAATCCAAATTAGAA
CCAATTAAATAAGATCTAGATCTTAATTGTTAACTTCAAAATTGCGATTCTAAAAGCCCT
GATAAAAAGTGTTCAAAGCTTAGTAAATAAGATGAAGACTAATCTTCAAACCCCTTTTTA
TCAACAATTTCAACTCTCTAGAGATAATAGTCTAATCCAGAATTATTACCATTAGAAAGT
TAAGTAATTTCAAACTCTCTTCCCAATAAGTTTGCTGAACAGCTTAGAATTTTAGACTTA
GAGATTCTTAAGCAAAATAAAAGTTAGGAAAATTTGAAGTCATTTTCTTCGATTCTTTTA
TCAAGCGAGGAAACTAAAAGTGAATATTAAATTTTTCAACAGTTTGGTACAAGTATCAAA
AGAGCTCTTTGGGTTATTGAAGATGACGAAGTTTATAAAGCAATTAAGTGTCAAGATATA
TGCTCTCCTATTTTTTTCACAAAGCAACCAAATCAAGATATTTAGTTTGGATTTGGAGTA
CAAAACTATTAAGAATTCGATAAAAAGAATGTATTGAATCTCAAAGATGTTCAAGTGAAG
TTTACTCATACTAACTTTGTTGAAATAAATGGTTAAGGTTTCAAGCATATCAGTTATGGT
AATAATAAACTAATTGAAAAGTAATATTAGCAGTTCTTAGAGACAAAGGAAAATAATTCA
ATATGCTTCTCAAATAAAAAAGATGCCTATAAAATTGAATTCTGTGATTAGATTCTTGTT
GAACAGGGAGTGATAAATAGTCCTAATCCGCTCACAGAAAGTTATACTATTGAGATGGTT
AATTAATTAGAACGACCAAATTGCTTTGATTACATTAAAACTTTTGATCGTGAATCCATC
TCAAACAGTTTTTCAAAAGGAAGAGTTCAAAAGCAAAAAGGTGTATAATTGCCAAAAGCC
TATGTAATCAAAATTGAAAAGATTATTAACAAGAAGTTGTATGAGAGATTTGTTATCGAA
TTAAAGTTTATGAGTGAGAAGTATCCGCAAAAAGATTTTGAAGATATAATGCAGCATCTA
TTTCATGGATCTTATTAAGTTGACCCTATATTAATCTATAACAGCAGCATTGGGTTTGAT
TTCAGATTGTCAAAGGAGAAATGTTTTTATGGAAGAGGAGCTTATTTTGCAAAGAACTCT
GGATATTCAGACTCCTATAGTTATATAATTCCTACTACTTCTCGATATCAAATATTTGTT
GCTCTTGTTTTAACTGGAGATAGCATCACCTTAAACAACAATGAGCCTGACCTATAAGCC
CCACCCTATAAACCTGGTAGTAATACTGAGAGATATGACTCTGTTCATAACGGATAGCAA
GATCATTTTGTAGTATATGATCATTACAGAGCATACCCTGGCTATCTAATCACTTATGAA
ACAGTTTGA


>Contig7116.0.g1(protein)
MFSQMKSIETEYKDELLSLDIFEYNVQEFGQSYIDDFYIDTKQQFEQIFKLQNQMSKDIE
LTKLFAQFSDLMGPANLSFAKISNRLMELKNVILSYFSCNQRGSSLRKYVLSYPSCFDTL
KIIKLTHLYLENADQESKLEPIKQDLDLNCQLQNCDSKSPDKKCSKLSKQDEDQSSNPFL
STISTLQRQQSNPELLPLESQVISNSLPNKFAEQLRILDLEILKQNKSQENLKSFSSILL
SSEETKSEYQIFQQFGTSIKRALWVIEDDEVYKAIKCQDICSPIFFTKQPNQDIQFGFGV
QNYQEFDKKNVLNLKDVQVKFTHTNFVEINGQGFKHISYGNNKLIEKQYQQFLETKENNS
ICFSNKKDAYKIEFCDQILVEQGVINSPNPLTESYTIEMVNQLERPNCFDYIKTFDRESI
SNSFSKGRVQKQKGVQLPKAYVIKIEKIINKKLYERFVIELKFMSEKYPQKDFEDIMQHL
FHGSYQVDPILIYNSSIGFDFRLSKEKCFYGRGAYFAKNSGYSDSYSYIIPTTSRYQIFV
ALVLTGDSITLNNNEPDLQAPPYKPGSNTERYDSVHNGQQDHFVVYDHYRAYPGYLITYE
TV