Identifiers and Description

Gene Model Identifier

Contig11469.0.g105

Standard Name

PARP1c

Aliases

Contig11469_0_g105

Description

Poly(ADP-ribose) polymerase catalytic domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006969402.000470901975128e-28hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11469.0.g105(coding)
ATGGAAATGACAAAACAAAGAACTTAATTTGCTGATGTGAATATGGGAAATCAGCCATTC
GGCGGTACTATTATGGAAGTACCCAAACCTGCCTAGAAAATACCTCCTCCAGGATTGCAA
CCTTATGAATTACATCTTTGGCAAGAACAGCAATAGCAAAAACACATTTAATCACAGCAA
TCAACAAAGCAATAAGAGCTCTTTAAATAGTAACAATAGCTTCTTGAAATTGAATAAATG
AGGTATTACCAGCAAATGTATGAAGCCAAATAAAAACAAACAGCCTCAACTTTAAAAGAT
ACATAACAAAAGAAGGAAGTAAAAGAAGCACAGAGGGAAGAACTAAAATAGAAACAGGAA
AGTTTCGAGGAGTCAGCTTTCAAATGCTTAGATGAAATCGCTGAGAAAATTGGCACTAAA
AAATCTATGGATGAGCTCAAAAGAAGGAGCAACAATGCAATAGCTGCCGTAAAATTTAAG
AACGGTGAATGCAATATCAAATTCGATATGAACGTTGAGGATTGGGAACAGATCTAAGAA
GAAGCTTCTTAGACTATGCCATTTAACGTCAAGTACATAGCTAAGCATGTCAAATCTGAG
GAAATTGGGAAAGTAATAAAAGAGTTCAATGTGGAATACAAAGCTTTTTTGCAAGATACA
AAAGTTTTCATCATCAGCGATCATGATTACCAAAAACTTAAGTCCAAAAAGAATAAGTAA
TCTAAGACTTAAAAGATTCGCATCTTTGGGCAGAAAGCTGAAAATGATGTAGTAATTGAA
ATAAAAAAGCTCTTCAAAAAATTCATAAAAAAAGAGCATGTTTCAGATCATAGCATTTTC
GAAGGCTGCGATGATATTGATGCAGTAGAAAGAACTCATTACTACAACTACTTGAAAGCT
TCTAAGTTAATTGATGAAATTCTTAAAAATTAAGGTATAAGAGAAACTTTGAGGTATGAA
GACTCTTCTTAAAACATTTCTGTGAAGACAACATTTGAACGTTATCGCTAAATTTCAGAT
CATACGAGATCGGTCTTTGAGTTGATTCAAACCGAAAAAATGAGACTTAATCACTACATT
GTCGTCCACAAAACAGATCTACCTGATCAGTAAACATTGAAAAGCAAGGTAGAAGAAAAG
TTCACTGTTCTTATTACAGATACAGTTATTGAAGACTCCTCTTACTTTAGTAGATATAGA
AGTGATATTTCAGATAAAAGACCAAGAATGAAATATAACTATGTCCCTTAAGATAAAGAA
ACTCATAAGAAAAAGGAGTATGAAATTCAAGTCACTGGAATAATGGTTGATTAAGCAATT
GACTATATTCGCAAAAAACTAGACGATTATGATTCTGAAGAGCCACAGATTCCATCGTTG
AAACCAGATGAACTCGACAAGTTGAAGGATCAAGCGAAAGCTTTGTCTTAAAAGTATAAG
GTATTCATTATCTTCAAGAAGACTGTAACTATTGTTGGGAAATAATCAAAGAACAGACTT
GGAAATGCTTTGAAGGAGTTCCAAAAGACTATCTAAGATATCTTAAAAGGAAATGAGGTG
ACCACAAAGTCCATGCAGCTAGCTGATGCTCCTAACCCCATTTTGACAAAGCTAATGAGA
GATGAGACTCAAAAAATCGCCTAAATTTAGAGCCAGTTCAATGTAAACATTAAAATCGAT
AAAGACAACTATATTGTCAGTGGAAATGACGAAGGAATTGCGCATGCCTTCAAAGAACTT
TCAATTATACAGCAGAAATTTGTTTCCAAAATGGTAAAAATGCAAATTACCAATCCAAAT
AGAATCAAAGCTATTGAAATGAAAGGAGGAGTGATTAACTGTGAGAAACAATACGAAATA
CAAATCATTTCGCTTACATAGTAATAGGCAAAATAACAAGAATAAAAAATGCATCCTGGC
ATAAAAGATTTTAATTAGAATGCTGTTTTGGTAGAAAATACTGTTCATCAATGGTCTTAC
AAGGTATTTTCAGCAGATGCAAACTACAAAGACAGACATGACAAAGTGAATGACTGGTTT
GACTATGATCCACACCAAAATTCATAAATAGAGTAGCATTACCAACAGTGCTGTTAATCT
AATAACTTCTTAACACCATACGAAATTATTGGAGATTAAAATCAAGTAAAGAATGGGTTC
ACTTATCATGTCATAGGCAAAAGCTCAAATATAGATACGTGGAAGTAGAAAAATACAAAA
ACTGGGTATGCAAGATAACTTCAAAGAAAAACATTCAAATCAATGGGAGCTAAAAATAGT
TATATGATTGCATAAGAATTGTATCAAGACTATGGGGAAGAGGTTAAAGGAGATGACATA
GTGGAACAGAAGCAATATTACGCAAAGGGACTTAAAGCAAAAGTGGATTTCTTCCTTACA
GATTTGGATAAGTTCTACAATTACCCTTACAACCACTCAATGACTCTCGAGTTGAAAAAA
TATAAGAAGGTCTTGAACTAAAACATTTTAAACAGTATGGTGCAAATCGCTTTGACAAAA
TTCCAGTGCCACTTTGCTCAAGGTTACAGTTTTGAAAGGATTAAAATTGTGGGCTTTAAA
TGCCATGATGCTGGCAGATAATTTGAAAGCATGCTTGATAAGGCATTACTCTTTGAATTT
CCTTAAACTTGGCAATAGATAGATCAACATATTTTGGAGTCTAAGGATCTTATCATTATT
CCTTTGGCTCAAGGAGATGCTGAATGGTTGAAGATTGAAAATCAATTTAAAGTAACAATG
CCTCAAGCCAAAATAACCAAAATTGAGAGAATTTAAAACAAAAAACTTTGGAGAAACTTC
AAGCATGCTGTGGATGATATAAGAGATAAATGGAATAAACCTGCTTAGACTCTAATGCTC
TATCATGGAACAAGAGGTACTGCTCCTAAATCAATCTATGACAGTGAAGAGGGGTTCAAC
ATGCTTTTCAGCTCAGGCGGTATGTGGGGATAGGCAATTTATTTTGCATAAAACAGCTCT
TACAGCGATGGGTATAAATATGCTGTTTCACAAACTACTTTCTAAATGTTCTTTGCAAGA
GTTCTAGTTGGTAATTATATCAAACTTCCAAGCGACAAATAGATCAAAATGCCTCCAGTT
GATGCTTAGGGTAAATATTATGACAGCATATAAGGACATACAGGAGGCTCAGACGTATTT
ATGATCTATGCAAACAAAAAGGCATACCCGGAATACCTAATTACATATCAGTGA


>Contig11469.0.g105(protein)
MEMTKQRTQFADVNMGNQPFGGTIMEVPKPAQKIPPPGLQPYELHLWQEQQQQKHIQSQQ
STKQQELFKQQQQLLEIEQMRYYQQMYEAKQKQTASTLKDTQQKKEVKEAQREELKQKQE
SFEESAFKCLDEIAEKIGTKKSMDELKRRSNNAIAAVKFKNGECNIKFDMNVEDWEQIQE
EASQTMPFNVKYIAKHVKSEEIGKVIKEFNVEYKAFLQDTKVFIISDHDYQKLKSKKNKQ
SKTQKIRIFGQKAENDVVIEIKKLFKKFIKKEHVSDHSIFEGCDDIDAVERTHYYNYLKA
SKLIDEILKNQGIRETLRYEDSSQNISVKTTFERYRQISDHTRSVFELIQTEKMRLNHYI
VVHKTDLPDQQTLKSKVEEKFTVLITDTVIEDSSYFSRYRSDISDKRPRMKYNYVPQDKE
THKKKEYEIQVTGIMVDQAIDYIRKKLDDYDSEEPQIPSLKPDELDKLKDQAKALSQKYK
VFIIFKKTVTIVGKQSKNRLGNALKEFQKTIQDILKGNEVTTKSMQLADAPNPILTKLMR
DETQKIAQIQSQFNVNIKIDKDNYIVSGNDEGIAHAFKELSIIQQKFVSKMVKMQITNPN
RIKAIEMKGGVINCEKQYEIQIISLTQQQAKQQEQKMHPGIKDFNQNAVLVENTVHQWSY
KVFSADANYKDRHDKVNDWFDYDPHQNSQIEQHYQQCCQSNNFLTPYEIIGDQNQVKNGF
TYHVIGKSSNIDTWKQKNTKTGYARQLQRKTFKSMGAKNSYMIAQELYQDYGEEVKGDDI
VEQKQYYAKGLKAKVDFFLTDLDKFYNYPYNHSMTLELKKYKKVLNQNILNSMVQIALTK
FQCHFAQGYSFERIKIVGFKCHDAGRQFESMLDKALLFEFPQTWQQIDQHILESKDLIII
PLAQGDAEWLKIENQFKVTMPQAKITKIERIQNKKLWRNFKHAVDDIRDKWNKPAQTLML
YHGTRGTAPKSIYDSEEGFNMLFSSGGMWGQAIYFAQNSSYSDGYKYAVSQTTFQMFFAR
VLVGNYIKLPSDKQIKMPPVDAQGKYYDSIQGHTGGSDVFMIYANKKAYPEYLITYQ