Identifiers and Description

Gene Model Identifier

Contig3410.0.g101

Standard Name

PARN1b

Aliases

Contig3410_0_g101

Description

CAF1 family ribonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000061901.999598840915195e-17CAF1 family ribonuclease conta
ining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3410.0.g101(coding)
ATGGAGATAACAGTAGAGAACTTTGAAGAAAAATTCGATCTAATTGCAAAATCTATCCGC
AGTTGCGAATTCATAGCATTTGACACAGAATTCAGTGGCTCCAAGATAGGCTACGAGGAC
AAGCCACATGAGTTCGATTCATTAGATGACAAGTATAGAAAGAACAGAAGTGCAGTTTAG
AAATTCCTGGCTTTTCAAGTTGGCATAACTACATTTATGTGGAGCAACATGAAGAAAAAG
TATATTGGAAGACCATTCAATTTTCTTGTTTACCCTAGACATATCTTACAGGAGAGATAT
CACCATGCTAATAGTGATACGATTGACTTCCTCAAGAGATACAGTTTTGATTTCAACAAA
GTTTTCAGATACGGACTTACCACACTAAAATTGACAATTGATAATTTCAAAATAAGACAG
CAGTTATCCAGAGAAATATTTAAGAAATTTGGGTTTGGGTACTTCAGAGTGGAGTTTTCT
AAGGATAATGACAGTTTTACTGTGGTTAGACTTTAATCAAATGAAGATACAGGCACTCCC
ATCTCCATGTCTTCTTTTAATAACACTGATGCTAAAAAGAACGGCAAAAGTTCAGTAAAC
TCTAAGTATCAAATGAGTGACAAAGATTTTGAAATGCAGAATAATCAGGAAGTTATTGAT
ATTACAGAGTATGAAATTGGTTTCTCAAAAGTTGTGGAAGAAATGATTAACGCAAAGAAA
CCTCTGGTTGGGCATAACATGATGCTGGATATAATGTTTCTTTATCAATAATTTATTGAT
GACCTTCCACTTACTCTCAGAGAATTCATAGTTAAATTTCAAGAGAAGTTTCCAGCAATT
TATGATACTAAGGCAATTTCATAAAATATGGGAGTGAATCTTTTCAACAACAAGACTGAT
CTTAATTCAATGTCTACTTAAATCTTGCAAAAATAGAAGTTTAAAAGCTATCTTGAATTT
GATTACGATATAGGTCATAATTTCACAAAGTATTAATCAAAGCAAATGCTGCATGAAGCT
GGCTATGACTCCTACTTAACAGGTTTGGTGTTTGCAAGTTTGATTAAATATCTGGAAGTG
TAGCATTTCAACAACTATCAGAAGAAGTTGTAGAAGCAGTAAGCCAATTTAATAAACACT
TATGGGGGTATATGCTCTGATTAAGATATGCTGAGTGATGGATAGAACAGTAGTAATAAT
TTACTATGCCAATTGAATAAACTTCAAATGATTGATTCTTAGCAAATAAGACCACAGTTA
TACACTTCACATAATTAATACATACCAAGTGCTCAAAGTGCCTAAGAACTAGCGAACTTG
CCAATTGTCCTAGATTGTGTCTAGGAATTCAAGAATTTCATTATGATTGCTCTTGAAGGC
TAAAAATTCATGAAATTTGACAGAAATTACAAGGATGACACTAAAATCAACGGAAATGTG
TTAAAAGTATAGATGAAGGAAGACATGAGTGCTTATGATATTAGCAAACTGCTCAGTGTA
TATGGGGATGTATTTGTTATCAAAGATTCTTAGTACGGTTGCTTCGTAGAATTTACATAT
CTAGAGTATGAACAGACTGATAAAAATTTCAATATTGAAGAATTAATTGCTATATTAAAA
GCAGACTTAAATATTTCCAAGAAAGTTTTATCAATAATTAATTGA


>Contig3410.0.g101(protein)
MEITVENFEEKFDLIAKSIRSCEFIAFDTEFSGSKIGYEDKPHEFDSLDDKYRKNRSAVQ
KFLAFQVGITTFMWSNMKKKYIGRPFNFLVYPRHILQERYHHANSDTIDFLKRYSFDFNK
VFRYGLTTLKLTIDNFKIRQQLSREIFKKFGFGYFRVEFSKDNDSFTVVRLQSNEDTGTP
ISMSSFNNTDAKKNGKSSVNSKYQMSDKDFEMQNNQEVIDITEYEIGFSKVVEEMINAKK
PLVGHNMMLDIMFLYQQFIDDLPLTLREFIVKFQEKFPAIYDTKAISQNMGVNLFNNKTD
LNSMSTQILQKQKFKSYLEFDYDIGHNFTKYQSKQMLHEAGYDSYLTGLVFASLIKYLEV
QHFNNYQKKLQKQQANLINTYGGICSDQDMLSDGQNSSNNLLCQLNKLQMIDSQQIRPQL
YTSHNQYIPSAQSAQELANLPIVLDCVQEFKNFIMIALEGQKFMKFDRNYKDDTKINGNV
LKVQMKEDMSAYDISKLLSVYGDVFVIKDSQYGCFVEFTYLEYEQTDKNFNIEELIAILK
ADLNISKKVLSIIN