Identifiers and Description

Gene Model Identifier

Contig14452.0.g115

Standard Name

PARN1a

Aliases

Contig14452_0_g115

Description

CAF1 family ribonuclease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005229500.0000000000499999055251093CAF1 family ribonuclease conta
ining protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14452.0.g115(coding)
ATGAATATAACTCGCTATAATTTTAGGTAGCAGCTTCCAGGAATATTGAAAAATTTACAA
GAAGCTGATTTTATCGCTATTGACTTTGAGTTCTCAGGTCTTCTGCAAAACTAATAAAAT
GCTAATTAAGCCTCAGATACTATTGCTCAAAGATATTGGAAGAATAAAGAGTCTGTTCGG
AAATTTATGCCAATTTAGATGGGAATATGCGCTTTCAAATATACACATGATTCAAAGAAG
ACCCTAACATGCTTCCCATACAATCTCAACATCATGCCTTCCTCTCTTAGAGATGAAAAA
ACTGTACTAAGTGAGGGTGATGGTAGTTTAGGGACAGGTGTCTAGGTGAGCAATTAACAC
AATTTCTATGTAGAGTAGACAGCTTATCAATTTCTTCAGTAATACAAATATGACTTTAAC
AAATTGTTCTATGAGTCAGTTGGTTATTTAAGCTATCAAGATTATTAGCAATATCTCGAT
GACATTAAACTTAAGTAGTACCAATTAGCTCTGGAAGAACAATAATTTGATTCACCAGAA
TGTACAACTTACAGCAACTCTCATTTCCTAAATCTATAAACCTGTCTTGAGACAGTAGGC
AGATTAATACCAAAAGAAGACCTCGAGACAGACCCTCGTAATGAATTGAAACTTGACATT
ACTTTTGCAAAATTTCAATTGTTTCATAGTTTACTCAGGAACATTCCAAAAATGTTTCCT
AAGGACAAACTGGATTATGAACTTATTGTAGATGACTAATAGGGTGATATGTACATTAAA
GTCAAGGTTACCACAGATGAGATATTAAGAAAAAGTATAAAACCTTTCACTTCCAATCAA
TAAGAGTTTAAAGAAATACTCGAGATAATTACAAACGAAGAGAAGTATGAAATAATTTTA
AAGAATCCATAAGATTTCTAAATTGAAAGTCTTGATAAAGTAGTATAGAAAGTATTTGAT
TCTATAAAATCAGTTGCTGAAAACTCTCTGGGTGCTTCAATCATACCATTATTTATTGCT
GCACTCTAAAAACCCTTAATTTTTTAGAATGGCATGCTAGATCTATTGCACCTATATGAT
AAATTTTACTAATCTCTCCCGGATGATATACTTGAATTCAGGTCAAATGTTAGCGTTTTG
TATCCACATATCTATGACAATAAAACTTTGATGAATAATTTCTCTGATATTGAAGCGACA
ATGAGAAATAATAATGGCATGAATTTAAGTGCTACCTATACAAGAGCGATGAAAGATGAC
TATAAATTTATGCAAACTGTGTAGATAGCTCCAGAATTTAGTGAATACAATTTGAACCTT
GATGAGAGTCATGAAGCAGGTTTTGATGCCCTATAAACAGGTGTGACTTTTTTCAAACTG
GCTACTTACCTAAATGGAAAAACCTCTTAATCTTATGATTTCCCTAAAATTGAAGAGCTC
ATTCAAGAATTCTCCTCAAAAGAAGAGTCTATAGTTAACTATAAGAATAAAATACCAATC
TATAATTAAAAGAAGCACTTTAACTTGCATCCAATTAAATCGCAACTACAATCAAATTAC
TCTACCACTAGTTCTTCTCAAACATAGAATAGTAATAATGTACAAAATGACTACATGTTT
GTCATTTAAAATCTACCAATTGATATTGACATTTTGGATTTACAGTAGAAATTATAGACC
TACTTAGGCATAGATACTTCCATATATGGGGATGAAGACCGTGTAAATCGATTATAAATA
CTAAAAACTTCTCAAACTAATGCAAACCTGGCATTACAGCATTAAAACTTGGAGGCACAA
TAAGATAACTTGTAATTAAATAATTCAGAAAATACAAGAGAAGTACACTTTACAGTGTTT
GGCAAATAAGCAGAAGAAAAATTAAACCAAATGCTAAAAGAATAAGTAGCTATAAACTTG
GATAGCATAAGTATGGGGAGCAAAATCATTGGATATTCTTAGAAATGCAAAAATTGCTTA
GAGGAGGCAGAGAGAAATATTAAGCAAATCTTTGAACATATCGAAAAACACATCGGTATG
ACTTGA


>Contig14452.0.g115(protein)
MNITRYNFRQQLPGILKNLQEADFIAIDFEFSGLLQNQQNANQASDTIAQRYWKNKESVR
KFMPIQMGICAFKYTHDSKKTLTCFPYNLNIMPSSLRDEKTVLSEGDGSLGTGVQVSNQH
NFYVEQTAYQFLQQYKYDFNKLFYESVGYLSYQDYQQYLDDIKLKQYQLALEEQQFDSPE
CTTYSNSHFLNLQTCLETVGRLIPKEDLETDPRNELKLDITFAKFQLFHSLLRNIPKMFP
KDKLDYELIVDDQQGDMYIKVKVTTDEILRKSIKPFTSNQQEFKEILEIITNEEKYEIIL
KNPQDFQIESLDKVVQKVFDSIKSVAENSLGASIIPLFIAALQKPLIFQNGMLDLLHLYD
KFYQSLPDDILEFRSNVSVLYPHIYDNKTLMNNFSDIEATMRNNNGMNLSATYTRAMKDD
YKFMQTVQIAPEFSEYNLNLDESHEAGFDALQTGVTFFKLATYLNGKTSQSYDFPKIEEL
IQEFSSKEESIVNYKNKIPIYNQKKHFNLHPIKSQLQSNYSTTSSSQTQNSNNVQNDYMF
VIQNLPIDIDILDLQQKLQTYLGIDTSIYGDEDRVNRLQILKTSQTNANLALQHQNLEAQ
QDNLQLNNSENTREVHFTVFGKQAEEKLNQMLKEQVAINLDSISMGSKIIGYSQKCKNCL
EEAERNIKQIFEHIEKHIGMT