Identifiers and Description

Gene Model Identifier

Contig22056.0.g50

Standard Name

PAPL1

Aliases

Contig22056_0_g50

Description

Poly(A) polymerase central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04928 ) Poly(A) polymerase central domain
  • ( pfam04926 ) Poly(A) polymerase predicted RNA binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKR002W9.997764199084386e-16PAP1 SGDID:S000001710, Chr XI
from 443232-444938, Genom...
T. thermophilaTTHERM_001513700.00000000000009996062864481225Poly polymerase central domain
containing pro...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22056.0.g50(coding)
ATGAAATAACAAACTAAACCTATTAGAAAAGTAATTTACCCAAGAACTTCACTTTTAGAA
ACTTTCAAGTCTCTCTATGACTAAGACCTACTGAAAGATGTCTCTGAAAATCTGGAAGAC
ACCAGCAGTTAACTTAACAGTTCAATCCCATCCCAAGCTTCTTAAGAGTCAACTAAATCA
GAAAATGAAAGGGATATTGCAGTAAACTTGTTAACTAAAAAGCTTGCGCCATTCTTTGAA
AAGTTGTATCTCGATCTTTAAGATACCTCAAACAGAGAAAAAGATCGCTACAGCAACTTC
CAAAGGATACCAACTGATCTTAATCCACTTAAAGATTTATTTAGGTTTACACCCTTTGGC
TCAGGTATGTTTGGGGGCTTTGATAAGCATTCTGACATTGATGTGCTACTATCCAGCTTC
AAGTTTTTGTTGTCAAGAGAAGATTTTTTCAGCAAATTTTCAGCATACCTTAAATCTCCG
GAAGTGGGAGCAATTATTCACTAAGAGATTCCTCAAGCATAGATTCCAATTATCAAATTT
GAATTTATGAGCAAATAGTTCGATGTACTTTACTGCTCTATGTTAACACCTATAAGCTAA
CATCAACGTTGTCAGCTTGAGAAGGATCAGTATTTCTTTGAGTTTTCAAATGTGGTGCAA
GAAAAAGTAGATGTTTTCTCATTTAGGGGTTGGTCTAACTGCTAATACATGTATGAAAGA
ATTAAAGATAAAGAGGCTTTTGGCTGGGGACTCAAGATAATCAAGGCTTGGGCAAAGAAG
AAGGGACTCTATGGCTTTAACTTTGGATACCTTAACGGCATATCGCTCATAATCATGCTT
GGAAAAGTTGATAAAATGATCAGAAGAGAGAGATTTCAATCAGACTATTGCGATGATACT
TTAAGTAGAAATGTGAATAATTAATTATCATTCACAATTCCAAACAGAACTCTAAAAAGT
AACAATAAAATTGAAGATAGAGTTTGTGAATTAGTGACGAAATTCTTTGAAGTATACTCT
AAATGGGATAGCAAATAGCCAATTTTCTTCTAAGATAACAATTCATGGTCTATGGACCAA
GATCTGTACTCTGTTTGTCTGAAAGAAGTTTTCCCTATAGTTACTCCTGAGAGACCTTAC
AAATGCACAACTCATCAAATAAACACTAGCAGTCTAAATCACATAATGGAGCAATTGCAA
ACTGCTTAAAACCTATGCATACTAATCTAGAAAAGATAACTAATTTTAGATCTAGTTAAG
TATCAAAATGACAATGCCTTTGATAAGTTTGGAAATCCGAAAAAGGATAACTACAATTTG
AGTATATTGAAGGAGTTTGGATAAGTCACCTGGAAAGATTTGTTTAATCCATATCAGTTC
TTTACACAGCACACTATATTCTTATAGATTGAAGTGATGACCGATGTCAACATTAGCCAG
TACAACTATGACAATGTTCCAGATGATCCAATAGGACAGTATGAAGTCGTTCTCAAACAC
CATCATGAGTACAAAGGTCTTTTTGAGTCTCGTTTCAAACTTCTGTAACTTATGATGGAA
CAGTCTCTTGAAATTGAGAACATTTAGATATTCACAGACGTAATAGACAGAGATTTCACC
TAAAAGTCTAAGCTAATTGACTATAGAGGAAGCAAGTTTATCTCCTCACTTTACTATTTT
GGACTGCCTTACAAAGAGTTGACTGTTGAGTTGAAGAATCAAATTACAGGAGTTCTGTGC
AAGTTAATCATTAGCAATATCTAAAATAGCCCATTGACTCATGTTGAGCAGCACACTGCA
CATTTCAGATTTCTAAAATTTTCTCATCTTCCACCTGAAACCTTGCAATATTGCTTAGAA
AATTACATTGAGGGGTACAGTGAGATGCCATGCTATGCTGTTGAGCAATAGATGTCCAGT
GGTGACATTTGGGAAAAGATTCAAGAAGACCCTAACTACTTTGGAGAAGGTATGCAAATC
TATGAAGCAAAAGATTGA


>Contig22056.0.g50(protein)
MKQQTKPIRKVIYPRTSLLETFKSLYDQDLLKDVSENLEDTSSQLNSSIPSQASQESTKS
ENERDIAVNLLTKKLAPFFEKLYLDLQDTSNREKDRYSNFQRIPTDLNPLKDLFRFTPFG
SGMFGGFDKHSDIDVLLSSFKFLLSREDFFSKFSAYLKSPEVGAIIHQEIPQAQIPIIKF
EFMSKQFDVLYCSMLTPISQHQRCQLEKDQYFFEFSNVVQEKVDVFSFRGWSNCQYMYER
IKDKEAFGWGLKIIKAWAKKKGLYGFNFGYLNGISLIIMLGKVDKMIRRERFQSDYCDDT
LSRNVNNQLSFTIPNRTLKSNNKIEDRVCELVTKFFEVYSKWDSKQPIFFQDNNSWSMDQ
DLYSVCLKEVFPIVTPERPYKCTTHQINTSSLNHIMEQLQTAQNLCILIQKRQLILDLVK
YQNDNAFDKFGNPKKDNYNLSILKEFGQVTWKDLFNPYQFFTQHTIFLQIEVMTDVNISQ
YNYDNVPDDPIGQYEVVLKHHHEYKGLFESRFKLLQLMMEQSLEIENIQIFTDVIDRDFT
QKSKLIDYRGSKFISSLYYFGLPYKELTVELKNQITGVLCKLIISNIQNSPLTHVEQHTA
HFRFLKFSHLPPETLQYCLENYIEGYSEMPCYAVEQQMSSGDIWEKIQEDPNYFGEGMQI
YEAKD