Identifiers and Description

Gene Model Identifier

Contig1142.1.g3

Standard Name

PAP1b

Aliases

Contig1142_1_g3

Description

Poly(A) polymerase central domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam04928 ) Poly(A) polymerase central domain
  • ( pfam04926 ) Poly(A) polymerase predicted RNA binding domain
  • ( pfam01909 ) Nucleotidyltransferase domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYKR002W4.999723464643358e-28PAP1 SGDID:S000001710, Chr XI
from 443232-444938, Genom...
T. thermophilaTTHERM_001499003.0002687256732656e-20Poly polymerase central domain
containing pro...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1142.1.g3(coding)
ATGGCAGAAAATAAGAAACATCATAGATAGAAAACCCAAGGGGGTTAAAACTACAACTCA
GGTGCTTATGTTCAGTCATAAAACCAATCCTCATATAATCAGGGCACCTAATAAAACTAG
GGTTATCACAAGAAAAGTGGCTTTCAAAAGAAAAACTATAACTACAAGAACCTAAATAGC
ACTAACAAAAATGAACAACATCTAGGCAGTGAAGATAAATAGAACGTAACTCAATAAAAT
CAAAATAAAAACATCATCTAAGAGTAAGTGGTGCCTGTAGTAAAATCTAACTTCGATGAC
CCATATGAGGAGACTCTGTACATGAAATTCTTGATGCGTGAAAAGTATACAATCTATGAG
GATTAAGAGTAGAAAAGGAAGAGATAGGAGATTCTGGCAAAGCTAAAAGATATCTTGGAT
AAGTGGTAAATTGAATGTGCAGTCAAAGATAGAAAAATATTGAGAGAGGATGCTGAGAAA
AGACATGCAAGTATACATCCATTTGGCTCTTATGAACTATAAGCACATTTCCCAGAGACA
GATATGGACGTGATATGTGTCCTACCTTCATACATTCTGCATGATGATTTCTTTAATAAA
TTCAAAAACCTCATTACCAGCTATGAAGAAGTAACTAATGTCATTGATGTAGTTGATGCC
AGGGTTCCTGTTTTAAAATTTAAGTTCTAGGGATTTCAGATTGACATGCTCTATGCTTGC
ATTGACTATAAACTTATTGAAAACAATCCAAAAATACCTAAGATGATCAAGGATGAAACT
ATCTTCAACAAACTTAGTTAAGGTGGTGTCTCATATGCTATTTTAGTGGCTAAAATTTGC
TAAGACAATACTGATCTTTACCTTTGTGACATTATTTACAAATTCTTTGAAGTTTATGCT
GACTGGAAGTGGTTTGACCCTGTCTTTATTAGAGTTGGGAAGAAGAAAGATAAGACTAAG
CTAGATTTGAATAAGCTTCAAGTTTTAGATGCTTATTCTCAGGATATCATGCCAATTTTA
ACTCCAAATACTAATCCTAAGAATTCTGCTTATAGAGTGTGCTCTCACACTTTTGATACT
ATTTGCAAGGAATTCACTAGAGGCAAGAATCTAATGAAAGAACTTATTCCATAATCTCAA
AAAACAATAAAACCTCATCCTGCAGCATTAGCAAAATTAGCATTAGATCAAGAAGAAACA
AAGCTAACTGTTGATGCTTTATAAATTTAAGAGTCAAATTAAGAATCTTAAGTATAATCA
CCAGTATAAAAGCAGAAGCAAAAACAGAGTTGGATAAAACTATTTTAAAAATTCAGATTT
TTCGATTAGTATGAGCACTTCTTGAAGATTGATATTCTTTCTACAGATGAATCAGCACAC
TTAAAATGGTTGGGTTATGTTGAGAGTTAACTGCGTAGATTGATGCAACTGCTTTAAGAT
ATAGAACAAATCTCTGGGCTGAGAATATACCCACGATCATTCAACAGGGAAGAAACATAA
GACACGATAAATAATGCTTTCAAGTGCTGTGATTCATACTTTATTGGAATCAAGTTTAAT
GAAGCAGGTCCAGGGGTCACTGTAAGTCTCAGAGATCAAGTTACAAATTTCTGCAACTTT
TTAGAAATAGGGAGAGTTACTAATACTAAAATGGAGTCAGAGATGCATGATTAATCTAAT
GATTAAAATTACAATGAAGCAAGAGATTACATTACACCTGATTTGAACCAAGATCATTCA
CTAATGAGAGACAATATGTTGGATAAAACACTTGATTTGCAGGAAGTAGCCCAAATTTAA
TAATAATCTATGAATTTGTAAGAAGATAATACCCTAACAGATAATGACCAGGATGATGAT
AATGATAACACTAATGAAAGAGAAAGAAAATAGAATTAGACCCCAAAGCCATCAATTAAA
ACTAGAAGATAAAGTCGTGGGATAGTTTACTTTAACCGCAAAAATCCTACTTAAGAGATA
ACAATAGGCACATTAGAGGAATGGTTTTAAGAAAACTAATTGAACAAGCATAAACGCAGA
AAATTAAATACTTAATTCACCTTGGATGAGAAAGAATCTAGAATGCAGTAAGATGACTAT
ATCGAACTGGATCAAGCCAAAATATAAGGAAGTTCTAGCAAGCTTAACAAGACTTTTCTT
TATGAAAATTGGTATGATGACTTCGAGAAAAACAGAAGAAAAGAAGAGAGAAACAAAAAG
CGCAAGAGAAGCGAGATAAACAATATAAGTAATAGATCAAGATCAAGAAGTCCTACTCCA
GTATCTAAAAGTGCTCCTTTAGTGAGTTAAGCAGATATTATTATGAGCAATAGAAAAAGT
AGGAAAGGCCCTTCTTCAGCATAGAGTGAAAACAGTGACTATCAACAAGATGTCCTAAAG
TAAAATACTGAACCTCAATTACCAAACATTAAATCACTGAAAGAAGAGGAAAAAGGTTAA
TCTCAGCAAACTAAACAAAAAAGGAATGACAACAAAGAAGTTACTAAGAAAACTCAAAAT
CAAACCAAGCAGAATTCTAAAAGTAATAACAATAAATAAACTGTGGATTAGAAAACTAAA
GTAAACAGCAATAAAGGATCTTAACTATCGAAGTAATCTTAAAATAAAGATGAAGAGGAA
TCTGAGTATGATTCAGAGGAGGAAGATAGAAAAGAAACTGAAAAGATAAAAGTAGAAATC
ATGAATGAACTAGAGAAAAAGGAAGAACCTTTAGATATTTAATACCTTAGCACTACTTTG
AAATATACTCAAAAGCACATTGAAGAAGGCTTGAAAACCCTTATGGGTGAGTCTAAGATT
ATCAAGAAGGAAATTGGCAAGAAAACTTACTTTATGTCAATAAACCAGGAACCTATTCGA
AACTATCAACAGAATAAAGCTGCAATCCTTGAGAAAGTAACAAAGCTCAAAGATCTTGAA
AAGACTAATAATTTATACGAATCAGATTTATAGAAATTAGAGAAGCAATTGAAAGATTTA
AAACTCAAGCCCACTGCAAATTAAGTCTAAAACGACATTCAATCTCTTATTGATTAAATT
CACTAAATAAAGCAAGAAATCGATGAGTTCAAGCACAGTCCATAGTTTTTAGGAGATCAT
ATTTTGCTAAAACTGAGGCAAATGTACCACAAATTAGATAAATTAATTGATTTGTATAAG
AAACGTAAAGATGGATGTGTTGATATGCTAGACTATTTTGCATAGCACCTAAACCTTGAA
TTATAGGAGATTGTAAGGAAATGTGGGATCGATTAGAATGATTTAGAACTTACTCCCGAG
CTGATTGAAATACTAGGAATTGACCCAGAAGATCTAAAGAAAAAAGAGGAAGAGGAGAGC
GAAGAAGTAGATGATGAAGAGGACGAAGAAGACAGTGAAGAGGAAGATAAATAGTCAAAA
AAGAAAGTGAAACCTTAGCCCAAGCCACGAACAACCAATAATAGTAGCAGGAGAAGAAAA
ACTTCATTTTAAGAGGAAGATATTGAGGACGTTGATAGTGAAACTGATGAAAGCGGCAAA
AGTGCAGGAGATGTCTCCAAGAAGTAATCTCAGAAATAAACTCCTTCAAAGCAGTAACAG
AATAAGTCGAAGTAAAATGCTCCCAAAGGGGCTGTCACTAACAATAAATTACAAAATAAG
AATGCAAGCAGCATTGATCAAATAATGAGTGAGGATGACATGAAGTCTAAAGATGATTGA


>Contig1142.1.g3(protein)
MAENKKHHRQKTQGGQNYNSGAYVQSQNQSSYNQGTQQNQGYHKKSGFQKKNYNYKNLNS
TNKNEQHLGSEDKQNVTQQNQNKNIIQEQVVPVVKSNFDDPYEETLYMKFLMREKYTIYE
DQEQKRKRQEILAKLKDILDKWQIECAVKDRKILREDAEKRHASIHPFGSYELQAHFPET
DMDVICVLPSYILHDDFFNKFKNLITSYEEVTNVIDVVDARVPVLKFKFQGFQIDMLYAC
IDYKLIENNPKIPKMIKDETIFNKLSQGGVSYAILVAKICQDNTDLYLCDIIYKFFEVYA
DWKWFDPVFIRVGKKKDKTKLDLNKLQVLDAYSQDIMPILTPNTNPKNSAYRVCSHTFDT
ICKEFTRGKNLMKELIPQSQKTIKPHPAALAKLALDQEETKLTVDALQIQESNQESQVQS
PVQKQKQKQSWIKLFQKFRFFDQYEHFLKIDILSTDESAHLKWLGYVESQLRRLMQLLQD
IEQISGLRIYPRSFNREETQDTINNAFKCCDSYFIGIKFNEAGPGVTVSLRDQVTNFCNF
LEIGRVTNTKMESEMHDQSNDQNYNEARDYITPDLNQDHSLMRDNMLDKTLDLQEVAQIQ
QQSMNLQEDNTLTDNDQDDDNDNTNERERKQNQTPKPSIKTRRQSRGIVYFNRKNPTQEI
TIGTLEEWFQENQLNKHKRRKLNTQFTLDEKESRMQQDDYIELDQAKIQGSSSKLNKTFL
YENWYDDFEKNRRKEERNKKRKRSEINNISNRSRSRSPTPVSKSAPLVSQADIIMSNRKS
RKGPSSAQSENSDYQQDVLKQNTEPQLPNIKSLKEEEKGQSQQTKQKRNDNKEVTKKTQN
QTKQNSKSNNNKQTVDQKTKVNSNKGSQLSKQSQNKDEEESEYDSEEEDRKETEKIKVEI
MNELEKKEEPLDIQYLSTTLKYTQKHIEEGLKTLMGESKIIKKEIGKKTYFMSINQEPIR
NYQQNKAAILEKVTKLKDLEKTNNLYESDLQKLEKQLKDLKLKPTANQVQNDIQSLIDQI
HQIKQEIDEFKHSPQFLGDHILLKLRQMYHKLDKLIDLYKKRKDGCVDMLDYFAQHLNLE
LQEIVRKCGIDQNDLELTPELIEILGIDPEDLKKKEEEESEEVDDEEDEEDSEEEDKQSK
KKVKPQPKPRTTNNSSRRRKTSFQEEDIEDVDSETDESGKSAGDVSKKQSQKQTPSKQQQ
NKSKQNAPKGAVTNNKLQNKNASSIDQIMSEDDMKSKDD