Identifiers and Description

Gene Model Identifier

Contig7166.0.g71

Standard Name

PABPN1c

Aliases

Contig7166_0_g71

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYIR001C2.000769134519826e-18SGN1 SGDID:S000001440, Chr IX
from 356895-356143, Genom...
T. thermophilaTTHERM_005815006.997351175151406e-18polyadenylate-binding protein
2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7166.0.g71(coding)
ATGAGCTGTAGCTTTTCAAGCAATACTATCAACTCTCAAGACACCAACAAAGCTTCTATC
ACATAAACCTCTGCGTAGTAGGAAAACTCAAGTATTTGGAGAGATGGTGCCAGCATTCAA
AATAATTCTGATCAAAATTCTAACCAGTTTTCTTTGTTGAATTAACAAAACACCAACTCC
AATTCGAACTCTATATCTTCAACTTAACACAGCATGTTGACCAGTGGTGGGCAAAAAAAC
AAGCCTCATGATGATTTGCTTGTTGAAAATAACATCAATTTGATTCATGGATTTGATATT
CTTAGTGGAAAAGAAGGGGGTGGAGGTCTAGAAGAGTTTGACTTTTCATTGGAAACTTCA
AGTCTTGCTAATGGAATTCTTGATCAGAACTTTGATGAATAGCGATATGAAATGGTGAAC
TAGGACTAAGCTAAGGTTGATACTTTGATAACTAGCAAGAGTAAAGAATCAGAAGCATTA
AGAACTTCAACTATTCCTGAGAATACTTCAAAGCTGGCTGATTCTGTAGATAAAACAGCA
AACTCAACTCTATTAGTTCCTGCAAGCCAACCTTTGCTTAGAAAGCAATCTTCTTCTACT
TCCTCTTCCAATCCTGCAACATCAACTAAGCCAAAGTATCTTACTCCTGAGGAGGAAGAG
TTAACACTAGCAAGGTCTATTTTTATTAAGAATGTAGATTACAAAACTACAAAAAATGAC
CTGGAGGATCATTTCAAGGAGTGTGGCTAGATCACTAGATGCACTATAGCTACTGACAAA
CACTCTGGGTAGCCTCTGGGGCATGCCTACATTGAGTTTGCAACACTTGAGGGTGCATAG
AGATCCAAACTCCTGAATGAAAGTTTGTTCAAAGGTCGTTAGATTACTGTTTAGCCAAAA
CGCAAGAACAAGCCTGGCTTTGGTCGTGGGAACGGTGGTTTTGGAGGTGGAAGCAAGTAT
CTAATGTCAAATCAAAACAACTTACTCTAGCAAGTCACTGCAATTACTAGTAGTTTGATT
ATGGGATCTATGATGGCAGGAGGCCCTGCTGGAATGATGGGTAGAGGCCGAGGTGCCATG
GGTTCTTCTAGAGGAGGTAACTTTGGAGGTTTTGGTATGTTTGGTAACTAGAGAGGTGGT
CGTGGTGGAAGAGGTAGACCCTATTGA


>Contig7166.0.g71(protein)
MSCSFSSNTINSQDTNKASITQTSAQQENSSIWRDGASIQNNSDQNSNQFSLLNQQNTNS
NSNSISSTQHSMLTSGGQKNKPHDDLLVENNINLIHGFDILSGKEGGGGLEEFDFSLETS
SLANGILDQNFDEQRYEMVNQDQAKVDTLITSKSKESEALRTSTIPENTSKLADSVDKTA
NSTLLVPASQPLLRKQSSSTSSSNPATSTKPKYLTPEEEELTLARSIFIKNVDYKTTKND
LEDHFKECGQITRCTIATDKHSGQPLGHAYIEFATLEGAQRSKLLNESLFKGRQITVQPK
RKNKPGFGRGNGGFGGGSKYLMSNQNNLLQQVTAITSSLIMGSMMAGGPAGMMGRGRGAM
GSSRGGNFGGFGMFGNQRGGRGGRGRPY