Identifiers and Description

Gene Model Identifier

Contig4061.0.g90

Standard Name

PABPN1a

Aliases

Contig4061_0_g90

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam08644 ) FACT complex subunit (SPT16/CDC68)
  • ( pfam05797 ) Yeast trans-acting factor (REP1/REP2)
  • ( pfam12446 ) Protein of unknown function (DUF3682)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYIR001C1.0002869940498747e-21SGN1 SGDID:S000001440, Chr IX
from 356895-356143, Genom...
T. thermophilaTTHERM_005815001.9991095569230066e-20polyadenylate-binding protein
2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4061.0.g90(coding)
ATGGAATCAACTTAGAAGAATCAAGTTTAAGATCCTGAAGTAAGCTAAAACGCTCCAGAT
CAGGCAAACCAAGGTGCTACCCAACCTAAAGACGACATTGCTGATTTCGAAAGTAAACAG
GAGGAATTAAGGAAGTTAGAGAACGAAGTTGAAGAAAGCAAGGAAGATTAGGAGGATGCA
GATGAGAGATCTGTGTTTGTTAAAAATGTGGATTATAGTGCTGAGCCTGCTGAACTTAAG
GATCATTTCAAGGAATGCGGGGAAGTCAAGAGAGTCACAATTCCAGTTGACAAGGCATCT
CAATAACCAAAAGGTCATGCCTTCATCGAATTCACAACAATCGAAGCTGCTCAAAAGGCA
AAGCGTCTGACAGACAGCTTGTTCAAGGGTAGACAAATTACAGTTATTCCAAAGCGTAAG
AATATCCCAGGCAGAGGCAGAGCAATCAGAGGAGGAGGTAAGAACCCCATGATGCAGTTG
GTTGGTATGTTGCAAATGGTCATGAACAGAGGTGGTCGTGGAGCCAGAGGCAGAGGATTC
AGACCATACTGA


>Contig4061.0.g90(protein)
MESTQKNQVQDPEVSQNAPDQANQGATQPKDDIADFESKQEELRKLENEVEESKEDQEDA
DERSVFVKNVDYSAEPAELKDHFKECGEVKRVTIPVDKASQQPKGHAFIEFTTIEAAQKA
KRLTDSLFKGRQITVIPKRKNIPGRGRAIRGGGKNPMMQLVGMLQMVMNRGGRGARGRGF
RPY