Identifiers and Description

Gene Model Identifier

Contig21044.0.g17

Standard Name

PAB1

Aliases

Contig21044_0_g17

Description

RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam00076 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam14259 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam13893 ) RNA recognition motif (a k a RRM, RBD, or RNP domain)
  • ( pfam00658 ) Poly-adenylate binding protein, unique domain
  • ( pfam11608 ) Limkain b1
  • ( pfam08777 ) RNA binding motif
  • ( pfam11767 ) Histone lysine methyltransferase SET associated
  • ( pfam03880 ) DbpA RNA binding domain
  • ( pfam03941 ) Inner centromere protein, ARK binding region

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER165W5.999781043483669e-32PAB1 SGDID:S000000967, Chr V f
rom 510373-512106, Genome...
T. thermophilaTTHERM_000239905.997612587164444e-16Splicing factor 3B subunit 4

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21044.0.g17(coding)
ATGATGAACATGCAACCCGCCCAACAACAAAGACAAATGGTCCCCCAACAAATGATGCAA
CAAATTCCCCCCCAGGTCTACGGAATGCAATAATAGTAACAAATCCCTCAAATGAATCCC
GGTGCCTACCTCGGTAATCCCGCAGCCATGCAACTCCCCGGTCAACAATTCAATGAGCAA
CTCTAAAATCTCTCTCTTGGAAACCCCCGTGCTGCTCCAGTTAGCAAAGAAGAGAAGAAC
AAGTTCCCCAGCTTGTACGTCAGCAACCTTCCAAAGGAAAACTTCTTTGATCTCGATTTC
TTCAAATTGTTCACCAGCCATGGTTTCAGACTTAAGAGCGCAAAAGTTGTGCTCCATAAG
AGAACTAGTAAGCCACTTGGTTATGGTTACCTCCAATTCAACTCCAAAGAAGAGGCAGAT
AGATGTCTTCAAGACATGAACAACTATGTGCTCAATGGTCAAGCTCTTAGAATCGTGCAC
TCAGTTTCAAAGTTCGATTATAACCCAAAGGCAAATCTTCTTGTGAAAAACCTTGATAAG
GAAGTAACTTAACAGGAATTATTTGATAGCTTTAAGCAGTTTGGTGATATTTAATCATTG
AAACTTGAGACCTATCCAGACGGTTCAAGCAGAGGTTATGCTTTCATCCAATTCCAAAGC
GAGGAAGAAGCTGAAAAAGCATTGAATGCCATGAATCAAGCTGAGATCAAAGGTAAGAAG
ATTGAGATCAACAGACATGAGAAGAAAGCTACCAGAGAGAACCCCCAACAAACCAAGTTC
AACAACTTGTTTGTTAAGAACTTGCCAAAGGGAACTGATGACGACTAGCTCAAGGGACTC
TTCGGCAAGTTTGGTGAGATTGAATCAGTCACTGTTCAACGCGATGAGTAAGGAAACCTT
AAGGATTACGGTTATGTCTGCTTTAAGGAACCCGATCATGCTGAAGCTGCCGTGTTAGAA
ATGAACAAGAAGTAGATTGACGACTAATTCTTGATCGTGAACCAGCACATTAGCAAGAAG
GACAATGAGCCCACTCAGGGATCAAGATTGAACCCAATCACCCAGAACTTGAATAAGACA
TTCAACTCCAACATCTACATTAAATTCATCCCCAATGAAGTTACTGAAGAAGAGCTCAGA
AAGACTTTCTCAATGAAAGACGCAAACATTGTGTCAATCAAGCTCACCAAGTTTGTCAAG
AAGATTGAAGACCAAGAAGTTCAACCATATCAATTCGCTTACATTCTCTATGATACCGTA
CTCGGTGCACAAAAAGCTATCCAGACCTTTGATTAATCAACTGTGTTTGGTAATAAGCCT
CTCTTAGTGGAACTTTGGGTGTCTAAGGAAGAGAAGGAGCAAGAGAGAAAGAAGAAAGAA
AGCCAATAAATTAACTAATTTATCAGCAACATTTTGAATCTCACCAGAGCTAGCTCATAT
CCTCCTCAATAACAGCCAGGTCAGGGCTACAATAACGTGTAGGGAGGTCCTCAAGGTCAA
GGTATGATGCCAAACTAATACAACCAAAGAGGTGGTGTTGGTCAGCAAAGAGGTGGCTAA
CGTGGAGGCAGAGGTGGCCCAAGAGGAGGTCACAGAGGAAATTACGCTGGTAATATTGGA
GGTCATCAATAATAATACGCATAAAGACCACCATAACAACCAGCTGCTTTCCCACAATAA
TACAACAATCCATAATTCTAACAATAATAAATCCAACCTCAATAATTTGGAGTACAACGC
GGATTCAACCCAGCTATGCCAATTCCACAATAATAATAATTCCAACAAATTCCATTATTG
CCTCTTCCAGAAGTTGACTTGGTTCAATTCCAGGCTGTCGTTGATATTGGTGAAAAGAAG
CAATTCGTTGGTAACTCTGTTTATCCAACTATCGAGTAAGCTTTCGGCCCACAATTCGCA
GGCAAGATTACCGGTATGTTAATTGATGAGAACGCTGTAGATTTCAATTTACTTCTCACC
AATCAACAATACTTTACTACCAAGGCCAGTGAAGCTATGAGTCTTCTCAGCCAAGCTTAG
ATGCAACAGCCATTAGTATCGTAAATGCAGCAACCCCTTAATGAGTGA


>Contig21044.0.g17(protein)
MMNMQPAQQQRQMVPQQMMQQIPPQVYGMQQQQQIPQMNPGAYLGNPAAMQLPGQQFNEQ
LQNLSLGNPRAAPVSKEEKNKFPSLYVSNLPKENFFDLDFFKLFTSHGFRLKSAKVVLHK
RTSKPLGYGYLQFNSKEEADRCLQDMNNYVLNGQALRIVHSVSKFDYNPKANLLVKNLDK
EVTQQELFDSFKQFGDIQSLKLETYPDGSSRGYAFIQFQSEEEAEKALNAMNQAEIKGKK
IEINRHEKKATRENPQQTKFNNLFVKNLPKGTDDDQLKGLFGKFGEIESVTVQRDEQGNL
KDYGYVCFKEPDHAEAAVLEMNKKQIDDQFLIVNQHISKKDNEPTQGSRLNPITQNLNKT
FNSNIYIKFIPNEVTEEELRKTFSMKDANIVSIKLTKFVKKIEDQEVQPYQFAYILYDTV
LGAQKAIQTFDQSTVFGNKPLLVELWVSKEEKEQERKKKESQQINQFISNILNLTRASSY
PPQQQPGQGYNNVQGGPQGQGMMPNQYNQRGGVGQQRGGQRGGRGGPRGGHRGNYAGNIG
GHQQQYAQRPPQQPAAFPQQYNNPQFQQQQIQPQQFGVQRGFNPAMPIPQQQQFQQIPLL
PLPEVDLVQFQAVVDIGEKKQFVGNSVYPTIEQAFGPQFAGKITGMLIDENAVDFNLLLT
NQQYFTTKASEAMSLLSQAQMQQPLVSQMQQPLNE