Identifiers and Description

Gene Model Identifier

Contig15818.0.g11

Standard Name

OTUD6Bc

Aliases

Contig15818_0_g11

Description

OTU-like cysteine protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004198202.9986068920536807e-84OTU-like cysteine protease fam
ily protein
SGDYHL013C0.00000019998969434520019OTU2 SGDID:S000001005, Chr VII
I from 78353-77430, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15818.0.g11(coding)
ATGGAAAGTTTGTAGCCAAGTCATGGCAATTCTAATTAGCCTCACTATACACAATTTATT
GAAGGGGAGCATGTAGATGTCTATGATTCTAAATAAATTCGTTGGTATAATGCCGAGATT
GTGCATGTTGACATGTAAAATAAAAGAGTATAAGTGCATTACTCAGGCCTTGGTTCTAAT
TATGATGAATTTATAGAACTTAATTCTCCAAGAATTTAGAAGTAATGGAGAGATGGGATG
GAGTTTAAGATAAACAATAGACTAGATATATTAGACAAGGATTTTAGATGGTTAGAAGCT
ACAATTGTAGAAATAACATCTTCTTCTAAAAAGATCAAAGTTCACTTTAGAGGATTTTCA
TCTTAGCATGATGAATGGATTGATTGCGTCAAAGAACGAAATAGAATATTGGAAGTTGGA
TCATTGTCGAACGGGTTTGGTTGGGCTAAGTTCAGTCAAAAGCGCAAATAAGAGCTTGAG
CCAATTAGGAGACAGACGGAAGAATTAAGGAAGCATAGTTTAAAGAATGTTAATCCAGTA
AATTAAAATGGAGGTTGGGGAATTCAAGCACCAGTCCCTTAAGCAATAGATTGGAGATTA
TAGGAAGCTAATTTCGCAAAAGCTCTCTATACAAAGCGCCTTAGAATCATAGAAACAGGA
AGGGATGGCAATTGCCTATTTAGAGCTATAGCTTATCAAGCATATGGGGATGAAGATGAG
CATCGCCTTGTTCGTCAGAAATGCATGGATTACATCCTTAGTGAAAAAGAGTACTTTAAG
GACTTCATAATTGGAGGAAATGATTCAAGTGTTGAGGCCTATGTCAATCGTAAAAGAGTG
AATGCAGTCTGGGGAGATGATGTAGAAATTCAAGCAATGTCTGAAATTTACAATCGCCCT
ATAGAAATTTATGCCTACTCAGCAGAGCCAATGAGAACTTTCCATGAATAAGATGGATCC
AATGAGCCTATAAGGTTAAGCTATCATGGAAAATCTCATTACAACTCGATTGTGAGAATG
GATTGGACCTATGAGAAAGTTTTCGTGAAAACAAAGGCAGGTGAAATAGAAGACGAAGCT
ATTAAGTTGAGTAAGCTGAGAGAAGAAAAAACGAATGAAGTTTAAAATTAAAATAACGTT
CAGAAAAAGATTGATGATTAAAGCGCAAGACTGATGTCTTAAATTATTATGAGGTCAAGA
GAAGATTTTCATATTTAGAGCAAATGCGACATGCAGTAAGCATTGTTATAGACCATAAAA
GATATTAATGCCACTAAGAGAAACATAGAGGATGAAAATTTAGAAAAAGCTTTAAAAGAA
AGTTAAATGGCTGTTTCTGAAGATGAAATTTTATAACAAGTTCTGAAGCAGTCTCTTGAA
GAATAAAATCAAGCTTAAAAAAGAAATTAGGATTTATTAAAGGGGATTAACTATGATGAT
GCTCTTTTATAAACTCTTCAAGCTTTGAACATTAACAATCCTTAGCCAAATTAGATCTTG
TTCAATATTAATCAACCTCACTTGATAACAGCTGGATGTTAATATGCTATGGAAAATGGC
TTTTCAATGGAATAAGGCATGGAGGCAGTCAGAAACGTGGGTGATAACCCTGAAATGGTC
ATGAGCTATTTATTTGAGAAGTATTGTATGTGA


>Contig15818.0.g11(protein)
MESLQPSHGNSNQPHYTQFIEGEHVDVYDSKQIRWYNAEIVHVDMQNKRVQVHYSGLGSN
YDEFIELNSPRIQKQWRDGMEFKINNRLDILDKDFRWLEATIVEITSSSKKIKVHFRGFS
SQHDEWIDCVKERNRILEVGSLSNGFGWAKFSQKRKQELEPIRRQTEELRKHSLKNVNPV
NQNGGWGIQAPVPQAIDWRLQEANFAKALYTKRLRIIETGRDGNCLFRAIAYQAYGDEDE
HRLVRQKCMDYILSEKEYFKDFIIGGNDSSVEAYVNRKRVNAVWGDDVEIQAMSEIYNRP
IEIYAYSAEPMRTFHEQDGSNEPIRLSYHGKSHYNSIVRMDWTYEKVFVKTKAGEIEDEA
IKLSKLREEKTNEVQNQNNVQKKIDDQSARLMSQIIMRSREDFHIQSKCDMQQALLQTIK
DINATKRNIEDENLEKALKESQMAVSEDEILQQVLKQSLEEQNQAQKRNQDLLKGINYDD
ALLQTLQALNINNPQPNQILFNINQPHLITAGCQYAMENGFSMEQGMEAVRNVGDNPEMV
MSYLFEKYCM