Identifiers and Description

Gene Model Identifier

Contig4411.0.g92

Standard Name

OTUD6Bb

Aliases

Contig4411_0_g92

Description

OTU-like cysteine protease

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005542801.000137892321693e-31OTU-like cysteine protease fam
ily protein
SGDYHL013C0.00000000000020009182674645818OTU2 SGDID:S000001005, Chr VII
I from 78353-77430, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4411.0.g92(coding)
ATGGGACATAAAAACAATAACAGAAATAAGCCTGAGAAAGGTGGAAAAAATAAGAACAAA
AATAAAAAAGAGTCTGAGCACATAGCTCGGTAATAGGAGAAAAGAGAGGAGAAAAAGACT
AAGAGAGAGCTAAAGCGAGAAAAGAACAAATTCAATAAAGCAAAGCATGAGTCTAACATG
TCAAAATTTAGACTTTAACTGGTTTAATATGGACTAAAAGTCAAAGAGATGGGTGGCGAT
GGCAATTGCTTGTTTCGATCTATCGCTGATTAACTCGAAGGAAATGAGAAATTGCATCGC
AAATATCGCCAGGAAGCTATTGAGTACATAGAAGCCAATAAAGAGATGTATGCACCATTC
ATAGAGGACGATGAGACTATCGATTAGTACCTGGGAGATATGGCTAAGGATGGAACTTGG
GGAGGTTAAATGGAACTTCAAGTTCTCTCGCTGATCTACAAGTTCAACTACATTGTGCAT
TAAGTTGACAATCCAATAATGGCCTTTTCAAATTTCGATTGGGGAGCTGTCCCCACACTG
CACATAAGTTACCACCTGGGTGAGCACTACAATTCAGTCCGACTGCTGGAAGACAACGGA
GACGGTCCAGTTATGCCAATCGGCCATGAACTCTAAATTAAAAACCCAATTCAAGAAAAT
GGCAGCAGCAATGGAAAATTAATTGAAGAGGAAAAGAAACAGCCAGAATCACTCACTATG
AACGAGCTCTGTTAATATGCCTTGCAATAAATCGGTGTTACAGATGCTGAAATAATGGAA
AAAGCAATTATATAATGTTTTGGATAGGACATATCAAATTTAGATTACGGATCTATAAGC
AGTACGTACAAGGCATTATCAGATGCTTATGAGGATATTGAGATAAATTTGATTTCTTAA
GGATTAGAGAAGAATGTATCGCTTAAAGATGACCCTGATGAAATGACTTATGAAGAAAAA
ATAAAGAAGTTAAGCAAAGACGATTTCATTTTAGGGGATGGTGATAAAATTATTGAAATG
CCCGCTAAGAATAAGAATTGCCCTTGTAACTCGAGGAAAAAGTACAAAAATTGCTGCTAT
ATTACGGACATATAAAGAAAAACTGAGTTTATTGAGGCAAAAAGTAAATTAGTATAGGAA
AATGCTGCTAATAAAAAAGGCAAGGGAATTTTAATGCTTTGA


>Contig4411.0.g92(protein)
MGHKNNNRNKPEKGGKNKNKNKKESEHIARQQEKREEKKTKRELKREKNKFNKAKHESNM
SKFRLQLVQYGLKVKEMGGDGNCLFRSIADQLEGNEKLHRKYRQEAIEYIEANKEMYAPF
IEDDETIDQYLGDMAKDGTWGGQMELQVLSLIYKFNYIVHQVDNPIMAFSNFDWGAVPTL
HISYHLGEHYNSVRLLEDNGDGPVMPIGHELQIKNPIQENGSSNGKLIEEEKKQPESLTM
NELCQYALQQIGVTDAEIMEKAIIQCFGQDISNLDYGSISSTYKALSDAYEDIEINLISQ
GLEKNVSLKDDPDEMTYEEKIKKLSKDDFILGDGDKIIEMPAKNKNCPCNSRKKYKNCCY
ITDIQRKTEFIEAKSKLVQENAANKKGKGILML