Identifiers and Description

Gene Model Identifier

Contig21631.0.g17

Standard Name

OTIWI6

Aliases

Contig21631_0_g17

Description

Piwi domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005069004.999934616708877e-52Piwi domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21631.0.g17(coding)
ATGGGCGGAGGAGGCTACCAATAGCAAAGAGGCGGTTTTTAGGGTGGCTACTAAAACTAA
TACCAATAATAGCAATAACCTCAGAGATAATTTCAAGGTTAACCACAGAGATCCTTTTAA
GCATTTAACGCTTAATCTCAGCCTGGAGTGGTCAGATTAGTAACAAACGACTTCAAAATC
ACAAGAAATAAAGATCATGGTGTTATTTATACTTATTCAATCGATTTTATCCCTGGTTTA
GCAAGCTCTGAACCGACTTTAACTGAGTCTCAACTTCAACAAATGCAATAAAACGCAAAA
TAATAAGACGATTCTCTTAATAAGAGCATGTCAAAACTCTCAGTGTCCACTGATTTGACT
TCGGTAGTAGGGGGAAGCCTCGAAACATTCCAAAAGTTTAAGATAATGACTGCCATAAAG
GATAAAATCAAATAAATCTATGGGAATTACATATTTGTAGGCACAAACATGTTTTCATCA
TCATTAGTCGATGAGTAGATATCAATTGAAACTACAAAGCCATTTATGGGTCGCTAATAT
TCAATTATAATACAAAGAGTGTCAGAGTTTTTGTTCGATGATTTAAGTAAAACGAAAATG
GAGGAACATCCAATGGCACTTAATTTTGTTAATAGTATTATCAAGAGTGGTTTGAGAAAC
TCGAATCTTGTATAAATAGGCAGAAACCCTCGTTTTTTCGATCCAGACAACATCAAAGTA
CATAAAGGTGCTTAAATCTGGCCAGGTTTTTTTACTTCAACTTGGATCTTTCAGCAAGGT
CTCTATCTAATCATTGATAACATTTCTAAATTCTTGTCAAGCGACAATTGCAAAGTAATC
ATCGATGAAATGTTTAGAAATAATGAAACTGAAGACTACATTTCAAGAGAATTTGAAGGT
GCAGTAGTTATGGTGTGCTATGGATTGCGTAGAACATATAAAGTTAATAGAATTAGATGG
GACTTAAATCCAATGACATATCAATTTACATAGGGAGAGTTTGGCGCTAGATCTACAATG
GTTGATTACTTGCAGAAAGCTTATGATGTTAGACTTACATATGGTAACTAGCCTCTTCTG
GAAATAAAGCAAAAGAGATCGAACATATACCTACCTCCAGAGTTATGCATTTTAGTAGGA
TTGCCACCCTCGATTAAGAACGATAAAAGAGCTTTGATTGAATTAAGGCAGAAAATATTC
TAAGAGCCTCATGAGAAAGTACAAAACTTATAGTACTTAAGCAGGAAGCTATCAATGTCA
AAAGAGTTAAAAGATTGGAATCTAGAACTTAGTGTAGGTTCAGATTAAATAGATGCTTAA
ATCCTGAAGAAACCACAGGTTTATAGTACAATAGTAAATAAACAACAATTTGCAGAGACC
AATGTCCTTAGAACCATAGTCCACTAACCAATTGACTTAGAAAAATGGGCAATCTTCTGT
ATGGAAAAAGATGTGTAATCAGCTTAAAATATTTAAGAGAAATTCCATTAACTCTCAAGA
GATAACAATCTGAATATTTTTGTAGATTTTGGAGATATAGTCGCGATGAATAATTAATCT
ACAGTTGAAGATTATAAGGATGCTATTAGATCTTATTTTAAAGAGTATTTGAAATTTGAC
CCAGCAAAGAAAACTACAGAACCCATAAACAGCAATAAAGTATAATTTTTCTTAGTAATT
ATCCCAGAATCAGCAAAGAGAGAGAAATTCTATGTTGCATTAAAAAATATCATCAACAGT
AACTATCCTGTAATTTCATAGTTTGTTACACTTAAAACTTTAAACAGTTTCAAAGATAGA
GTTTACTTGAATATATTGAGATAGATTAATGCTAAACTTGGTGGGGATCTATGGAGAATG
AAATTTAGTGAGGATATTCCAGAGAGAACTATGGTTTTCGGAATTGATGTTTGTCACAAG
GGTAAACAAAGTGTCATAGGATTTGTAGCAACATATGACAGATACTTGTGCAAGTACTAT
ACATAAGCTAGTCCTTAACCTGTGAAAGGTCAAGAAATCATTTCTTCTGGAATTTTGACG
GAATATTTTGCTGGAGCGTTAGAAGCTTATAAGGATTATAATGGAGGCTTATTACCAGAG
CAAATTTTTATCTATCGTGATGGTGTTGGTGATGGAATGAGGCAAGTCATCATTGATGAA
GAACTAGTCTAGCTTTAGAAAGTTATGCAAGATTTTTATAGAGATTCTGAAACCAATCAA
GTAAAAGAACCAAATGTAACTCTTATTTTTGTCAATAAGCGAGTTCGCTAAAGATTCTTT
GAAACAAATGCTGGTTAAATTTCAAACCCTCCAGCTGGAACTTGCATTGATTCTGGCTTT
GTCGAACAATCAGAAGTGATTTCTGGAAAATTTGATTTCTTTTTAGTGCCTCATTAAGCA
ACTCAAGGTGCCGTAAAACCTACTCATTTCTATGTGGGCCATAATAACTCTTCCATAAGT
AAAAGTGCAATTATTAACTTCACTTATGCTCTATGTTTCAGCTACTATAACTGGCCTGAC
TCAATTAAAGTTCCTGCTCCATGCATGCTAGCTGATAAAATTGCAATTTATAGAACTGAA
GTTGGAAACATACCATCAACATTAGATATGCACAGACTACCGTTTTTCTTGTGA


>Contig21631.0.g17(protein)
MGGGGYQQQRGGFQGGYQNQYQQQQQPQRQFQGQPQRSFQAFNAQSQPGVVRLVTNDFKI
TRNKDHGVIYTYSIDFIPGLASSEPTLTESQLQQMQQNAKQQDDSLNKSMSKLSVSTDLT
SVVGGSLETFQKFKIMTAIKDKIKQIYGNYIFVGTNMFSSSLVDEQISIETTKPFMGRQY
SIIIQRVSEFLFDDLSKTKMEEHPMALNFVNSIIKSGLRNSNLVQIGRNPRFFDPDNIKV
HKGAQIWPGFFTSTWIFQQGLYLIIDNISKFLSSDNCKVIIDEMFRNNETEDYISREFEG
AVVMVCYGLRRTYKVNRIRWDLNPMTYQFTQGEFGARSTMVDYLQKAYDVRLTYGNQPLL
EIKQKRSNIYLPPELCILVGLPPSIKNDKRALIELRQKIFQEPHEKVQNLQYLSRKLSMS
KELKDWNLELSVGSDQIDAQILKKPQVYSTIVNKQQFAETNVLRTIVHQPIDLEKWAIFC
MEKDVQSAQNIQEKFHQLSRDNNLNIFVDFGDIVAMNNQSTVEDYKDAIRSYFKEYLKFD
PAKKTTEPINSNKVQFFLVIIPESAKREKFYVALKNIINSNYPVISQFVTLKTLNSFKDR
VYLNILRQINAKLGGDLWRMKFSEDIPERTMVFGIDVCHKGKQSVIGFVATYDRYLCKYY
TQASPQPVKGQEIISSGILTEYFAGALEAYKDYNGGLLPEQIFIYRDGVGDGMRQVIIDE
ELVQLQKVMQDFYRDSETNQVKEPNVTLIFVNKRVRQRFFETNAGQISNPPAGTCIDSGF
VEQSEVISGKFDFFLVPHQATQGAVKPTHFYVGHNNSSISKSAIINFTYALCFSYYNWPD
SIKVPAPCMLADKIAIYRTEVGNIPSTLDMHRLPFFL