Identifiers and Description

Gene Model Identifier

Contig19536.0.g60

Standard Name

OTIWI5

Aliases

Contig19536_0_g60

Description

Piwi domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005069002.9986404383886433e-43Piwi domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19536.0.g60(coding)
ATGTCGCATTTTAACTATAACAATCCAAACAATCAACAGCCTTCCTCTAATAACTAAGAC
AACCGTAGCAGAAGCAGGGAGAGGCAAACCAACTATTTAGGGAGGGGAGACGATTACAGA
GGTAGAGGAGCTAACCCTAGAGGCAATAATGAAAGAGGAGGACCAGGACCATTTAGACAA
GCACCTCAAATCTCAACAGCTTCACTCAAGGGATCACTGCAACTTCAATCCAATCACTTC
AAGTTTGGACTAAAGAATGCTTTGAACACAATAAACATGTACAGCATTGAATATTAAGCA
CTTGGCCAAGTCATTGACTTCTAAGCAAAGTTTTCCATTATAAGAGATTTGAAGGAGCAT
TTAAAATAAATCTATGGACTCTATATTTGTTAAAGTGATAACTTGTTTACTCAAACTCTT
TTCAGTGAACCATATATTGTCGAATGTTAATATCATGGCAGTCCTGTTCAAGTCACAATA
AATCTAAAGAATAGCTTTTCGCTTGATGAAAGCACTTAAAAGCAGAAACCATTCATGGAT
AAATTACTGAATTATGTTTTAATCCTTTGCAAAAAAGCACTTTTAGATGAAAAATACAAT
CAGCTAGGCAGACTTCCTCGGTTTTATTCAAGTTTTGAGAGTGTCAAAATCAACCAATAT
AGATTAGAAATGTGGCCTGGTTATGAGTTTAGTGTTAAATGCTTGCATGATGGCATCTTT
CTAAACGTAGATACTAGAAATAAGTTTGTCAATTAGCAAACGATATATGATAGAATTAGG
TAGTATAAAAGGGAGAGATACTCTGATGAAGAAATAAAAAATATGCTTCAAGAAGAAGGA
AAATTAGTTGTTATCACAAGATACAATTCCAAGTAGTATTTGATTAATGATATTGATTTT
GATATTACTCCTTAAAGCTACAAGTTTGATTGGATTTATGTTGATCCTAACACTCTCTAA
AAAGAAAGAGTCACTACAAATATGATTGATTACTTCCGGATGAAATATGGAATTTAAATC
CTTTAATCTGAGGCTCAATAACCTTGCCTAATTGTAAATAGAGGCCCTACTTCCATAGTC
TTACCAAGTTCTTTGTGTAATGAAGCAAACCTACCTGCTGGTTTTACTAAAGATAGAATT
AAAATGAAAAATTTGTAGCCCTATAAACTAAGTAACCCAAAAGATAGGTATTAAAGAATC
TCAGAAATTGTCAGTAAAATTAAAGAAAACCCAGTCTTTGCTTAATGGGAAATTTAGCTT
CAAAAAGATTTCGCAAATGTGAAGGCCAGACAATTAAATCATCCATAAGTCTACAATTAA
TATAACATGCTTTCTAATTTCGAAGAGTATGAAGAAAAGAAATTCTATCATGCAGAGCCT
ATTGAGTTAGGCTTCGAAAGATGGGCAATGGTTTATAGTTCAGAAACAGAAGAGTTTGAA
TATGCAACAAAATTAGTACAATGCATGTAACAATGTTCTAGATCCCTTGGAATTAAAATT
GAAGATCCCCAATGGATTGAGGTGCCAGATTTGAAGACACCCCAGGATATGATTGATTGC
ATGAATGTTGATATTGACTTATCTTATACATAATTTGTAGTTGTACTGATTCCAGGTAGA
AGCCTGAAACCAGATATTAAAAGACATTTGGATTCTCTAGGGTTACCATCTTAATTTGTA
CTGTCTAGCACTGTCTCTAGGTTAGTTGATGGCTAAAGACCTAAACTCGGTCCTTTTAGT
ATGATTCTAAAATAAATTAATGCAAAGCTACAAAAAGATCTGTACAGACTTCACTTACCT
TACTTAAGGAGATCTATGATTATTGGCATTGATACAGCAAACCAAGGAAATAAATCTCTC
ATAGGTCTTACTTCGTCATACAATAGTTATTTAACACAGTATGAGTCGAACCTTGAGAAG
CATTAACTTCCACCAAGGAAAGAATTTCCATCATAATATGAGCGCGAATTTTTTGTTGCT
TAAGAGAGAACAAAAATAATTATAAAGTTCTTGAATAATGCTCTAAAAACTTACCAGAAC
AAAAATATGGGACTGCTACCAGAAAGGATAGTAATCTTCAGAGATGGTATAGGTGGCCCA
ACGATGAAAGTTCAATGTGAGGAAATAGAAGTCAACGAGATAATTGCACATTTGAACTAA
ATCTAACTAAATTACAAACCATAAATAATTTACACTCTTATTGATAAAATGACTAGTCAT
AGACTATTTTTGAAAAGTAATTAGGATGTGTGGAATCCTGGTCCAGGAACTGTCTTAGAT
ACTGCTTTGGTAGAAAATTAAGGGGATCATATATTTGACTTTTTTATGATACCCCACAAA
GCATCTGTTGCTACTGCAATGCCAGTACATTTTATGGTAGTTTACAATAACTCTCTTGAA
GAGAAAAAGAACATAGAGAACTTTATCTATCATTTATGCTATGGATACTTCAATTTTGTA
GGTCCTATTAAAGTTCCTGCTGCTGTGATGTACGCTAAAAAGCTGATAAATTATGCAATA
GATAATAAGATATCTCTGCCGAACCCTAAGTTAAGTCAATCACTACATTTCTTATGA


>Contig19536.0.g60(protein)
MSHFNYNNPNNQQPSSNNQDNRSRSRERQTNYLGRGDDYRGRGANPRGNNERGGPGPFRQ
APQISTASLKGSLQLQSNHFKFGLKNALNTINMYSIEYQALGQVIDFQAKFSIIRDLKEH
LKQIYGLYICQSDNLFTQTLFSEPYIVECQYHGSPVQVTINLKNSFSLDESTQKQKPFMD
KLLNYVLILCKKALLDEKYNQLGRLPRFYSSFESVKINQYRLEMWPGYEFSVKCLHDGIF
LNVDTRNKFVNQQTIYDRIRQYKRERYSDEEIKNMLQEEGKLVVITRYNSKQYLINDIDF
DITPQSYKFDWIYVDPNTLQKERVTTNMIDYFRMKYGIQILQSEAQQPCLIVNRGPTSIV
LPSSLCNEANLPAGFTKDRIKMKNLQPYKLSNPKDRYQRISEIVSKIKENPVFAQWEIQL
QKDFANVKARQLNHPQVYNQYNMLSNFEEYEEKKFYHAEPIELGFERWAMVYSSETEEFE
YATKLVQCMQQCSRSLGIKIEDPQWIEVPDLKTPQDMIDCMNVDIDLSYTQFVVVLIPGR
SLKPDIKRHLDSLGLPSQFVLSSTVSRLVDGQRPKLGPFSMILKQINAKLQKDLYRLHLP
YLRRSMIIGIDTANQGNKSLIGLTSSYNSYLTQYESNLEKHQLPPRKEFPSQYEREFFVA
QERTKIIIKFLNNALKTYQNKNMGLLPERIVIFRDGIGGPTMKVQCEEIEVNEIIAHLNQ
IQLNYKPQIIYTLIDKMTSHRLFLKSNQDVWNPGPGTVLDTALVENQGDHIFDFFMIPHK
ASVATAMPVHFMVVYNNSLEEKKNIENFIYHLCYGYFNFVGPIKVPAAVMYAKKLINYAI
DNKISLPNPKLSQSLHFL