Identifiers and Description

Gene Model Identifier

Contig13836.0.g22

Standard Name

OTIWI2

Aliases

Contig13836_0_g22

Description

Piwi domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011610409.99838497179609e-146Piwi domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13836.0.g22(coding)
ATGGAACTTTAATTGGCAAAGAGACCAAGTCAATCTTCCCTCGCAGTGGGAAAGAAAGTT
AACTTAATGACGAACTACTATCGCTTTAACTTCACAAACCCAAAAAAGAACTAGATTTTT
AAATATGCAGTAAAATTCAGTCCAGAGCTACCAGACAACTCGAATAAAGTGAGAAGCAAA
ATCGTTAACAAAATTAGGAAGGATCTTCATGAGTATCTAGGCTTCTTTATTTTTATGGGT
GGATGTGTGTACTCTTTAGAAAATTGCTAAGATATACCTTAGTTTAAGAGTGAGTTTGAG
GAACAACCTTATGTTTTAGACTTTATTTGGGTTTAGCACATTGGAGAGACTGATAATGAC
AAGTTAATCTTTTATAAGATCTTCTTCAACTCACTGCTTAAAAAGATAAGATACAAGTAA
ATTGGCAGAAACTTCTTCAACCCTAACTAATCAAAAGTCCTAGCTCAATATAACCTAGAG
ATATGGCCTGGTTTCGCTTCTAGTTTGCAAATGCTCTAAAACGGAATACTTTTAAACATG
GATATCTGTCATAAAGTTATAAGAACAGATACTGTACTAGACTTTATCAATGATATAAAA
AACAAAGCTAGAGGCGATCCAAGAGAAGAAATAAATAGAGCCTTGCAAGGTACAACTGTT
ATGACCACTTACAATAAGAGAACTTATAGAGTGGAGGACATTAACTTTGAAATCAGCATG
AAAGATACTTTTCCACAAGAAGATGGCACTGAGATATCCTATTTAGAATATTTCAGACAA
AAGTACGGAAAAGAAATAAGAGATGTGAACTAACCAGTGATTGTAAATATAAACCCTAAA
ACTGGAAATAAAATCATCTTGATCCCTGAACTCTGTTAAATGACTGGTTTGTCCGACTCA
ATGCGCTCTAACTTCAATTTAATGAGAGACATGTCTCAGATTACCAACACTGATGCCACT
AGAAGAGTTTAAGAATGCAAACATCTCCTTGAGTCTTTCAAGTTAAATGAGAAATGCAGA
TAAGAAATGGATAACTGGCAAATCGAGATATCTGATGAGCCCATTGAAATTCAGGGTCTG
AAGCTATCAGCTGGAAACATGGTTATGGGCAAGAGCAGCTCAGGAGTTAGGATGGAGTTT
GACATTGAAACTACTCATGACATTGACAGGAAAATACAATCTAAAATGTATGATTAGCCT
GATCTGAGCAAGTGGGGAATATTCTTCTCGGAGTTTGATAAAAGGACTGCTTAATAATTT
ATGGAGATAATGCAAAAATGCTGTGAGCAGTTCCAGTACAAAGCTTCAAGACCTAGAGAA
TTCCTTGTTAGGGGAACTAGACCTTCAGATTGGATGCAAGCCATTAAAGATAACCTGAAT
AACTCAGTTTAAGCAGTCGTGCTAATACTACCTGGGTAAAAAGGCAAAGCTCCTCTTTAT
GATGATTTGAAGAAACTCTTACTTAAAGAAGTTCCAGTGCCCAGTCAAGTTGTCTTGTCA
AATACTTTAACAAGAGGCAAAAACGTGAGATCAATCTGCAATAAGATACTTATATAAATT
TGTGCAAAGATTGGTGGCGAACCCTGGGCTATTAGTGATATGCCTTACTTCAACAAGCCA
ACCATGATTTGTGGAATGGATGTCTATCATAAAATTGGTCAAGGTACTAAATCAATCTTA
GCAGTAACTGCTAGTATTAATTAAAGAGCGACAAAGTACTGGTCATGTGCGAGAGTCTAA
GATGAAGGACAAGAAATTTCAAACATCCTTCAAGAAATAATGGTGGAGGGGCTTTAGAAA
TTTAATGATAAAAACGGCTGTTTCCCATAAAATTTAATAATGTACAGAGATGGAGTGGGT
GAATCATAAAAAGGAGTTGTGCTTTCAAACGAACTTCCATAAATTCAGCAAGCTTTGAAA
AGACTAGGGTGCAGTGAGACATGCAAAGTAATGATAATAATAGTAAATAAAAGGGTAAAT
CAAAGGTTATTCAATACTGACAATCCAAGCAGACTTACTAATCCATTGCCAGGAACCATT
GTTGACTCAGGGATAGTAAACAAAGAAACTTATGATTTCTTCTTAGTTTCTCAAGTTGCT
AGAGTGGGGGTGGTTAGTCCAACCCACTATACAGTAGTCTATGATTCAATAAATGAAGAT
GCTGCAAAAATTTAGTTACTGACTTACAAACTGTGCTACACCTATTACAACGTTTCAGGT
TCAATTAAAGTGCCTGCACCTGTACAATACGCACACAGATTGAGCAATTTAATTGGAGAT
AGAGCAAAGGGACACATGGGAGTACCTATTCCACATGAACATTTCTCTAAGAACATTCAA
GGGCTTTATTTCATTTGA


>Contig13836.0.g22(protein)
MELQLAKRPSQSSLAVGKKVNLMTNYYRFNFTNPKKNQIFKYAVKFSPELPDNSNKVRSK
IVNKIRKDLHEYLGFFIFMGGCVYSLENCQDIPQFKSEFEEQPYVLDFIWVQHIGETDND
KLIFYKIFFNSLLKKIRYKQIGRNFFNPNQSKVLAQYNLEIWPGFASSLQMLQNGILLNM
DICHKVIRTDTVLDFINDIKNKARGDPREEINRALQGTTVMTTYNKRTYRVEDINFEISM
KDTFPQEDGTEISYLEYFRQKYGKEIRDVNQPVIVNINPKTGNKIILIPELCQMTGLSDS
MRSNFNLMRDMSQITNTDATRRVQECKHLLESFKLNEKCRQEMDNWQIEISDEPIEIQGL
KLSAGNMVMGKSSSGVRMEFDIETTHDIDRKIQSKMYDQPDLSKWGIFFSEFDKRTAQQF
MEIMQKCCEQFQYKASRPREFLVRGTRPSDWMQAIKDNLNNSVQAVVLILPGQKGKAPLY
DDLKKLLLKEVPVPSQVVLSNTLTRGKNVRSICNKILIQICAKIGGEPWAISDMPYFNKP
TMICGMDVYHKIGQGTKSILAVTASINQRATKYWSCARVQDEGQEISNILQEIMVEGLQK
FNDKNGCFPQNLIMYRDGVGESQKGVVLSNELPQIQQALKRLGCSETCKVMIIIVNKRVN
QRLFNTDNPSRLTNPLPGTIVDSGIVNKETYDFFLVSQVARVGVVSPTHYTVVYDSINED
AAKIQLLTYKLCYTYYNVSGSIKVPAPVQYAHRLSNLIGDRAKGHMGVPIPHEHFSKNIQ
GLYFI