Identifiers and Description

Gene Model Identifier

Contig1484.1.g65

Standard Name

OTIWI13

Aliases

Contig1484_1_g65

Description

Piwi domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011610409.99838497179609e-146Piwi domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1484.1.g65(coding)
ATGGAACTTTAATTGGCAAAGAGACCAAGTCAATCTTCCCTCGCAGTGGGAAAGAAAGTT
AACTTAATGACGAACTACTATCGCTTTAACTTCACAAACCCAAAAAAGAACTAGATTTTT
AAATATGCAGTAAAATTCAGTCCAGAGCTACCAGACAACTCGAATAAAGTGAGAAGCAAA
ATCGTTAACAAAATTAGGAAGGATCTTCATGAGTATCTAGGCTTCTTTATTTTTATGGGT
GGATGTGTATACTCTTTAGAAAATTGCTAAGATATACCTTAGTTTAAGAGTGAGTTTGAA
GAACAACCTTATGTTTTAGACTTTATTTGGGTTTAGCACATTGGAGAGACTGATAATGAC
AAGTTAATCTTTTATAAGATCTTCTTCAACTCACTGCTTAAAAAGATAAGATACAAGTAA
ATTGGCAGAAACTTCTTCAACCCTAACTAATCAAAAGTACTTGCTTAGTATAACCTAGAG
ATATGGCCTGGTTTCGCTTCTAGTTTGCAAATGCTCTAAAACGGGATACTTTTAAACATG
GATATCTGCCATAAAGTTATAAGAACAGATACTGTACTAGACTTTATTAATGATATCAAG
AATAAAGCTAGAGGTGATCCAAGGGAAGAAATAAAGAAAGCCTTGCAAGGTACAACTGTT
ATGACCACTTACAATAAGAGAACTTACAGAGTGGAGGACATTAACTTTGAAATAAGTATG
AAAGATACTTTTCCATAAGAAGATGGCACAGAGATATCTTATCTGGAATATTTCAGACAA
AAGTACGGAAAAGAGATAAGAGATGTGAACTAACCAGTGATTGTAAATATTAACCCTAAA
ACTGGAAATAAAATCATTTTGATCCCTGAACTCTGTTAAATGACAGGTTTGTCTGATTCA
ATGCGCTCTAACTTCAATTTAATGAGAGACATGTCTCAGATAACAAACACTGATGCCACC
AGAAGAGTTTAAGAATGCAAACATCTACTCGAGTCTTTCAAGTTAAATGAGAAATGCAGA
TAAGAAATGGATAACTGGCAAATCGAGATATCCGATGAACCTATTGAAATTCAGGGTCTG
AAACTCTCAGCTGGGAACATGGTAATGGGCAAGAGCAGTTCAGGAGTTAGGATGGAGTTT
GACATTGAAACTACTCATGACATTGACAGGAAAATTCAATCTAAAATGTATGATTAGCCT
GATCTGAGCAAGTGGGGAATATTCTTCTCGGAGTTTGATAAAAGGACTGCTTAATAGTTT
ATGGAGATAATGCAAAAATGCTGTGAGCAGTTCCAGTACAAAGCTTCAAGACCTAGAGAA
TTCCTTGTTAGGGGAACTAGACCTTCCGATTGGATGCAAGCCATCAAAGATAACCTAAAC
AACTCAGTTTAAGCAGTCGTGTTAATCCTACCTGGGTAAAAAGGCAAAGCTCCTCTATAT
GATGATTTGAAGAAACTTTTGCTTAAGGAAGTTCCAGTGCCCAGTCAAGTTGTCTTATCA
AATACGTTAACAAGAGGCAAAAACGTGAGATCAATCTGCAATAAGATACTTATATAAATT
TGTGCTAAGATTGGTGGTGAACCCTGGGCTATTAGTGATATGCCTTACTTCAACAAGCCA
ACCATGATTTGTGGAATGGATGTCTATCATAAAATTGGTTAAGGAACTAAATCAATCTTA
GCAGTAACTGCTAGTATTAATCAAAGAGCGACAAAGTACTGGTCATGTGCGAGAGTTTAA
GATGAAGGACAAGAAATTTCAAACATCCTTTAAGAGATAATGGTGGAGGGACTCTAGAAA
TTTAATGATAAAAACGGCTGTTTCCCATAAAACTTAATAATGTACAGAGATGGAGTGGGT
GAATCACAAAAAGGGGTTGTGCTTTCAAACGAACTTCCATAAATACAGCAAGCTTTGAAA
AGACTAGGGTGCAGTGAGACATGCAAAGTAATGATAATAATAGTAAATAAAAGGGTAAAT
CAAAGGTTATTCAATACTGACAATCCAAGCAGACTTACTAATCCATTGCCAGGAACCATT
GTTGACTCAGGGATAGTAAACAAAGAAACTTATGATTTCTTCTTAGTTTCTCAAGTTGCC
AGAGTGGGGGTGGTTAGTCCAACCCACTATACAGTAGTCTATGATTCAATAAAGGAAGAT
GCTGCAAAAATTTAGTTGCTGACTTATAAACTGTGCTACACCTATTACAACGTTTCAGGT
TCAATTAAAGTGCCTGCACCTGTACAATACGCACACAGATTGAGCAATTTAATTGGAGAT
AGAGCAAAGGGACACATGGGAGTACCTATTCCACATGAACATTTCTCTAAGAACATTCAA
GGGCTTTATTTCATTTGA


>Contig1484.1.g65(protein)
MELQLAKRPSQSSLAVGKKVNLMTNYYRFNFTNPKKNQIFKYAVKFSPELPDNSNKVRSK
IVNKIRKDLHEYLGFFIFMGGCVYSLENCQDIPQFKSEFEEQPYVLDFIWVQHIGETDND
KLIFYKIFFNSLLKKIRYKQIGRNFFNPNQSKVLAQYNLEIWPGFASSLQMLQNGILLNM
DICHKVIRTDTVLDFINDIKNKARGDPREEIKKALQGTTVMTTYNKRTYRVEDINFEISM
KDTFPQEDGTEISYLEYFRQKYGKEIRDVNQPVIVNINPKTGNKIILIPELCQMTGLSDS
MRSNFNLMRDMSQITNTDATRRVQECKHLLESFKLNEKCRQEMDNWQIEISDEPIEIQGL
KLSAGNMVMGKSSSGVRMEFDIETTHDIDRKIQSKMYDQPDLSKWGIFFSEFDKRTAQQF
MEIMQKCCEQFQYKASRPREFLVRGTRPSDWMQAIKDNLNNSVQAVVLILPGQKGKAPLY
DDLKKLLLKEVPVPSQVVLSNTLTRGKNVRSICNKILIQICAKIGGEPWAISDMPYFNKP
TMICGMDVYHKIGQGTKSILAVTASINQRATKYWSCARVQDEGQEISNILQEIMVEGLQK
FNDKNGCFPQNLIMYRDGVGESQKGVVLSNELPQIQQALKRLGCSETCKVMIIIVNKRVN
QRLFNTDNPSRLTNPLPGTIVDSGIVNKETYDFFLVSQVARVGVVSPTHYTVVYDSIKED
AAKIQLLTYKLCYTYYNVSGSIKVPAPVQYAHRLSNLIGDRAKGHMGVPIPHEHFSKNIQ
GLYFI