Identifiers and Description

Gene Model Identifier

Contig2665.0.g98

Standard Name

ORC4

Aliases

Contig2665_0_g98

Description

AAA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR162C0.00000008001913847069386ORC4 SGDID:S000006366, Chr XVI
from 868304-866715, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2665.0.g98(coding)
ATGTCTTACGATCCAAAAGCTTTCACTAACAATCTCTCAAAGAGTGGAAAAGTCATTCCT
GTCTTTGATGATAATTCTAAACATAGAAAATAATCTAATGATTCCAAAATGGATATTGAC
TAAGGGAATAATAATTTCTAAAAACCCCAACCAAAGTTTAACAAAAAAGAGGAGAAAAGT
CCTAGAATGATGGCAGTAAGATCTAAGTCAAGAGTGCACAACCCTGTCGACTTGAGCATA
TATTCTGCTGCAATTTAGAAACTCATTGTGAAACTTACAAACCTCAACAAGAATCAAATT
GAATTGTACTATGAGCATAACTATCAAGAAGTTTTGGGAATTCTGGGAACTTCTTATAAA
TTGGGCTAGACTAATTCTATGCTTCTGCTATCAAGAACTAAATAGACACTTCACGCCTTC
ATCTCAAAAATTTCAGAGGATATGATGTAGTTAATGCATCAATGGGACTCTCACAGTAAA
CTGAAAGTTATCAGAGTAAATTCAATTCTCTGCAACAGCGAATCTAAAATCCTTCAAAAA
CTATGTGAGAGCCTTGATTTGAAGCACGTCTCACAGTAATTTCACAGTTTAGAAATGATG
GATCACATCAAAGAGTACTTTGACAACAACAAAAACATAGCAGTGTGCTTTATCCTGGAG
GACATTGACTACTATGTGGAGACTACCAAGCAAGTACTGCTGTATAAAATCCTAGACATG
TTTGGCCAGATTAAACTCAAATTCGTGTTCATTGCTACTTCCATGAAGCAAGACATTGCT
GATTCATTTGAAAAGAGAATTAAGAGTAGATTCAGTCATAGAATGCTACTATTTTACGAG
TAATCTATGGAGAACTTTTCAAAGGGAGTCACCAGCATATTCTCAGACATTCTATTTGAA
GTTGATGACTAAAACACTAGGGAGTGTTACAACCTCCTTCAAAGTATAGTCACAAGTGAC
GAGACTATGGAAACACTACAAGATGAATTTGAATTTGGAAAAAACTATGAATATCTCGCG
TAGATGCTTAGAATTACACTCAGCAGTTTAGACTAAATATTGCAATAGAAGATTCTTTCT
GCAGATTAAGATTAAATCTAGAAGTTTGAAATAAGGCAGGTCATGACACAGCTTTTCTTT
ACTTAACTGGAAAATTTCACGTAGTTGAAGCAAAATTCAGAGCCAGTGAGAATTCTTGAA
AAAATGACCAGAGCTTAGTTAATTGTCTTAATTACAGCTATGAAAGTATCAGATAAAGCC
AACATCTTCAATTTCGAAGCAGTTTATCAAAAATACCTAGCTTTTATGAAAAATCATAAA
ACCATGCTGTAACTCTCAAAGCAAGTCTTCTTGAAAACATTCCTAGATTTAGCTGATTCT
GGATTCATTAAGAGTGAAAGTGAGACTGAATTACTCAGCGTTAATAACAAAATTGCACTG
GGTTTTCAAAAGAAAGATCTAAATGAAATGCTTTATCTATGTCAAGGCAAACTGGAATTA
CCTAAACTATTGGAAACTTGGGCTCTACAAAAATCCGATTGA


>Contig2665.0.g98(protein)
MSYDPKAFTNNLSKSGKVIPVFDDNSKHRKQSNDSKMDIDQGNNNFQKPQPKFNKKEEKS
PRMMAVRSKSRVHNPVDLSIYSAAIQKLIVKLTNLNKNQIELYYEHNYQEVLGILGTSYK
LGQTNSMLLLSRTKQTLHAFISKISEDMMQLMHQWDSHSKLKVIRVNSILCNSESKILQK
LCESLDLKHVSQQFHSLEMMDHIKEYFDNNKNIAVCFILEDIDYYVETTKQVLLYKILDM
FGQIKLKFVFIATSMKQDIADSFEKRIKSRFSHRMLLFYEQSMENFSKGVTSIFSDILFE
VDDQNTRECYNLLQSIVTSDETMETLQDEFEFGKNYEYLAQMLRITLSSLDQILQQKILS
ADQDQIQKFEIRQVMTQLFFTQLENFTQLKQNSEPVRILEKMTRAQLIVLITAMKVSDKA
NIFNFEAVYQKYLAFMKNHKTMLQLSKQVFLKTFLDLADSGFIKSESETELLSVNNKIAL
GFQKKDLNEMLYLCQGKLELPKLLETWALQKSD