Identifiers and Description

Gene Model Identifier

Contig6689.0.g11

Standard Name

ORC2

Aliases

Contig6689_0_g11

Description

Origin recognition complex subunit 2

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam04084 ) Origin recognition complex subunit 2
  • ( pfam11495 ) Archaeal transcriptional regulator TrmB

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006845607.999528511121947e-28hypothetical protein
SGDYBR060C4.9988726541653934e-26ORC2 SGDID:S000000264, Chr II
from 362514-360652, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig6689.0.g11(coding)
ATGGAAGATGACTCTCACCTAAATGAGAGTCCAGGACATCCCATATAATATAACCAGCTT
AATGAATAATTTGGAGATCTTTCTTCTGATGAAGAGGATGACATCGATCAAACCTTATAG
TAGAAAAAAGTAAAGACTTCAAATAAAACTTACAATGAGTTTTTGTTAACTCATAAAAAT
TTGAGCTAAAAAACCAGTCATTATTACTTCCCAAACTATTTTGAATCATATAAACTCAGA
GCAAAAGTTACAGAAGCAGAAGAGACAAGAGGAAAAAATGAGATTTTGCAAGGAGACTTT
AATAAAAATCAGTAAATGAAGTAAAAAGAAAATCAGAAAAAGTTGAAGGAAGCTTCAAAG
AAGAAGTATTTTACTGACGCAGAGGATACACTTGGTCAAGCAAGCGATTATGAAGAGATT
CTCAAAAGTGGAGTGATGGGTTAAGAGGCCTAAAGTTTGATTCACCACAAAAATGAAGAA
GAACTTCAAAGGATGGAAGAAAATGACTTAACCAGAAAGCATCTTTCATAAAAGAGAAAA
CACTATGCTCAAGTCAGCAGTTCAGCCAACTTCACTTAGATGAAGTACTATCTAGAGTGT
GGATTCAATTTGCTTGTATATGGAGTAGGGAGCAAGAGAAACTTAGTTAATCAATTTGTT
CAATCTTATTTAAGTGAAGACCCAAAGTTAATAGTCAATGGATTTCATTCTGGAGTTTCC
ATAAAATCTATTACTAATCCCATGGTTAAATTTGTCATGAAGCTATTCTAAATCAAAATT
GGTTCTCATGTGCATGATTAGATCGAAGAACTTAAGAGAATTTTCAACAACATCAGCAAT
TAAAACGACAAATTCAGTAAATATTACATAGTTATTCACTCAATGGACGCTGGCCCTTTG
AAGAACCCAGAGTGGTAAAAATATTTGAGTGAACTCGCCAATGTGAGAGGCATATCGATG
ATTGTTACTGTCGACCATTTTAAATCTGGAATTATGTGGAGTGATATGCTTTTAGATAGA
TTCAATTTTTACTCATTCTAATTGGATACTTTTGAAGACTATGATACAGAGCTTGAATAC
TAAGCTCCCTTGTTTTCTACTAAAAATGATAACTAAGAAGTTGGACTGTGGTTTGTATTG
CAAAGTATGACTTCAGCTCAAAAGCAAGTCATCAAAACTATTGCAAAATATCAACTAGAC
AATCCTAATGAGCCAGGAGTTACTATGAAGGCATTGATGGCAGTATGTGTTGAGAACATG
GTTGCATATAGTCAAAAAATGATCAAAGACTACTTAAACGAAGCAATGGATCATAAAGTA
GTTTTAGAGAAGCATGATAATGACGGTCACTCTTTCCTCTACATGAACTACCCTATTCAA
ACACTTGAAAAGATGGCTAATGATGAATTTAAGTGA


>Contig6689.0.g11(protein)
MEDDSHLNESPGHPIQYNQLNEQFGDLSSDEEDDIDQTLQQKKVKTSNKTYNEFLLTHKN
LSQKTSHYYFPNYFESYKLRAKVTEAEETRGKNEILQGDFNKNQQMKQKENQKKLKEASK
KKYFTDAEDTLGQASDYEEILKSGVMGQEAQSLIHHKNEEELQRMEENDLTRKHLSQKRK
HYAQVSSSANFTQMKYYLECGFNLLVYGVGSKRNLVNQFVQSYLSEDPKLIVNGFHSGVS
IKSITNPMVKFVMKLFQIKIGSHVHDQIEELKRIFNNISNQNDKFSKYYIVIHSMDAGPL
KNPEWQKYLSELANVRGISMIVTVDHFKSGIMWSDMLLDRFNFYSFQLDTFEDYDTELEY
QAPLFSTKNDNQEVGLWFVLQSMTSAQKQVIKTIAKYQLDNPNEPGVTMKALMAVCVENM
VAYSQKMIKDYLNEAMDHKVVLEKHDNDGHSFLYMNYPIQTLEKMANDEFK