Identifiers and Description

Gene Model Identifier

Contig20978.0.g107

Standard Name

ORC1

Aliases

Contig20978_0_g107

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008650501.99927841627239e-68hypothetical protein
SGDYML065W2.0006622580855403e-35ORC1 SGDID:S000004530, Chr XII
I from 142210-144954, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20978.0.g107(coding)
ATGAAAGGATCAAGCTAAAATATGAACAAAAAGCGTACAAGATCAACATTCAAGGATGGT
CTGGAGTCAAACTACGAGACAGACGAGCAGCGAAATAAAACCACTCACAAGCATAGAAAA
GTTCAGGAGTAGAATGTCAAGCAAGAACCCATTCCAGCATAAAACTAGAAATAGAATAAG
CAATTCGTGGATAAGGATGTATTCAACTTTGATGAGCATTTGAATAATAAAAGACCAACT
ACTGGTATGAGACTAAGAGATCGGTCGGTGTCACAAACAAGAAATGATACATCCATAAAA
AACTAGAAAGCCAATAATACTTCTGATGAGGATGGTCCTACTCTTATGTTGAAAAACAAC
AAGCTCAAAATTGAAAGTAAAAATGAATATCAATCAAGGAACACTCAAAGAAATCAAAGT
GCCAAAAATTACTTGACTGATAATAGCGTTGCACCTTATAATGCATATTCAACAAGAACA
AGAAATCAAAAATAGACTTAATAACATCATGACCACAGTGTAGGGAGCAGGACAGCATAG
AAAGGTGGAAAAGTGACAAAAAACAATAACATCAATGATCACAATAGTTTGAGTGACAGT
GTTAGTGATATTGATGATAGTCCCACACTTGACAATAGAAAGGCACTTTTGAGTAAGAAG
CAGCGTGAACTTAGTAGTAAAACTCAAAAATCAAAGCCAAAGTCTGCCAAGCAACCAATC
TCTAAAAATTCAAGAAACCATCGTAATAATGAGCAGATCGAAGAGGAGGATGAAAGTTTG
ATGAGCAGCAGTGGCAGAAGCAGCGAGGAAGAAGATACAAGAAACAAGGGATTTTAGGAT
GAAGTAGAGATGGATGAGTATGATTAAGCTTGTGAAAAGTTGCAGCTTAATTCCATTCCT
GATTCATTCCCATGTAGAGGCAAAGAGAGAAAGTATATCGAGGAATATCTTGCTAATGGA
CTGAAGAATAAGGGATGTAGTTCATCATTATACATATCAGGTATGCCAGGCACTGGTAAA
ACAGCAACTACTCTGGAAGTCATTAAGAAATTCAAAGCTCAAAAGTAAAACAATTTCAAG
TTCCTTCACATAAATGCTATGTCACTAACAAATCCAAACTTAGTGTACACTGTGATACAC
GAGCACATCACACGCAAAAGAGTAAATCCTACAAGCGCAGCTGATTTCTTGGATACATTC
TTTAAGAAGAAAGATAAACAGAAGCTTTTGCAATAGTATGTGAATGGAAAGAAAACAGGT
GGTGCTAGTAAACGCAATTAAAAGAATATTGTTAGAGGGTCATATGATCCTAAGAAAGAA
GCTGATATAGTTAGAGTGGTATTGATAGATGAGCTTGACGCCCTAGTAAACAAAAAGCAA
ACTTTATTGTACAATTTATTCGACTGGCCCTGCCACCAAAACTCCCGCTTGCTGATTATA
GCCATTGCAAATACTATGGATCTACCAGAGAGATTGCAAGCTAAAATTGCCAGTAGAATC
GGTAACAGCAGACTGGTCTACGAACCATATAATAAAGATTAGATTCAAACTATTCTAGAA
AGTAGACTACATGGAATACCCATATTTGATAGTTCTTCAATTAAACTTGTCGCCTCAAAA
GTATCTTCATATAGTGGAGATATCCGTAGAAGTTTGGCAGTGACTAAAAGAGCAGTTGAA
CTTTGTAAACTTTAATACTTGAAAATATGTTAAGATAATCTAAAAGCAAAAATTAAACAC
ACTGAGTTAATGAAGGTAACCTATCATCACGTGCAATCTGCTTTCATGGATCTCTACAAT
TCAAAAACCTGTCAAGTATTACGTGCACTTCGTAACTATGAAGTTCTAGTTATTTTGGCA
ATCTATTCAGAATTAATCGTTCACAAAAAAGAAAAAGTGCTCCTAAATGATGTGCAGGTT
CGTTGCGATAATATGCTAAAGACAGTGAATTGGAAACATAAGTTTATGACCACTAATGTA
TTCAGAGAGATTGTTAAAAGACTGCATAGTTTTGGCTTAGTTGCCATGCATATTGAAAGT
CATAAAATTACCGATAATGTATGGCTGTAACTTTATGTATACTATGATGAGCTGAAGCAG
TCATTTTTTGAGAATGAGCTCTTCAAAATATAAGAAGCAAATTTCAGCATTCACTAAGGA
AACAGTACTTCTTGA


>Contig20978.0.g107(protein)
MKGSSQNMNKKRTRSTFKDGLESNYETDEQRNKTTHKHRKVQEQNVKQEPIPAQNQKQNK
QFVDKDVFNFDEHLNNKRPTTGMRLRDRSVSQTRNDTSIKNQKANNTSDEDGPTLMLKNN
KLKIESKNEYQSRNTQRNQSAKNYLTDNSVAPYNAYSTRTRNQKQTQQHHDHSVGSRTAQ
KGGKVTKNNNINDHNSLSDSVSDIDDSPTLDNRKALLSKKQRELSSKTQKSKPKSAKQPI
SKNSRNHRNNEQIEEEDESLMSSSGRSSEEEDTRNKGFQDEVEMDEYDQACEKLQLNSIP
DSFPCRGKERKYIEEYLANGLKNKGCSSSLYISGMPGTGKTATTLEVIKKFKAQKQNNFK
FLHINAMSLTNPNLVYTVIHEHITRKRVNPTSAADFLDTFFKKKDKQKLLQQYVNGKKTG
GASKRNQKNIVRGSYDPKKEADIVRVVLIDELDALVNKKQTLLYNLFDWPCHQNSRLLII
AIANTMDLPERLQAKIASRIGNSRLVYEPYNKDQIQTILESRLHGIPIFDSSSIKLVASK
VSSYSGDIRRSLAVTKRAVELCKLQYLKICQDNLKAKIKHTELMKVTYHHVQSAFMDLYN
SKTCQVLRALRNYEVLVILAIYSELIVHKKEKVLLNDVQVRCDNMLKTVNWKHKFMTTNV
FREIVKRLHSFGLVAMHIESHKITDNVWLQLYVYYDELKQSFFENELFKIQEANFSIHQG
NSTS