Identifiers and Description

Gene Model Identifier

Contig2625.0.g80

Standard Name

OGG1a

Aliases

Contig2625_0_g80

Description

8-oxoguanine DNA glycosylase, N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam07934 ) 8-oxoguanine DNA glycosylase, N-terminal domain
  • ( pfam00730 ) HhH-GPD superfamily base excision DNA repair protein
  • ( pfam05979 ) Bacterial protein of unknown function (DUF896)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_012434504.000437458487249e-40HhH-GPD superfamily base excis
ion DNA repair ...
SGDYML060W4.000352986427571e-28OGG1 SGDID:S000004525, Chr XII
I from 151871-153001, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig2625.0.g80(coding)
ATGTCTAAATTAATTTGGAAGCAGTTAGTATTCCATAGATAGGAGTTTAACCTAGAAAAT
ACCCTAGTTAATGGTTAATGCTTTAACTGGAAAAAACTTGGTGAAGATCATTTTGAAGGT
GTATTCTCTGAGTATTACGTGCAAGTAAAGAGAACTCATGATGACTATATAGAGTATTGT
ACTATTCCAGATCATAAAATCTAAACTTCACAAATTCAGCCTTAGGATTCTGAGAAAAAA
ACAAAGAAAATAAATAAAATCGAAGAAGAAAAAAAGGTTCGCTAATAACCAGAGGAAGAA
GAGAAGACGTCTCACTAAACTTAAGATAAATTTCTTGATTAATTCAAGGCATACATAAAC
TACGATATTAAAGTGTTAGACCTTTATGATCACTGGGCCAAAAGAGATAAAAGATTTAGT
TAGATTGCAGAGCCTATTCATGGAGTAAGATGCTTAAGACAAGATCCCTGGGAATGTACT
GTATCATTTATATGTTCATAGTGCAATAACATCAAACGTATCACTTAAATGCTTGATACT
CTCAGATAGAAATATGGCACTAAAATATGCGAGATAGACTAAGACGATGGTTCAAAGAAA
AGTATTTACAAATTTCCTACTATCGAGTAAATGTCTTAAGTATCAGAGAAAGAGTTGAGA
GATCTTAAATTCGGATACAGAGCTAAATACCTTGTTGCAAATGCCAAAACGATGAATGAG
AAAGGTGGGAAGTAATGGCTTGAAAGTTTAAGAGGTAAATCTAATGAAGAAGTTAGAGAG
CAGTTAATCACTCTAAATGGAATCGGAAACAAAACACCCATGTCTTTCAAATTGCCTAAA
AATTAGGATATGTACAAGGAATGA


>Contig2625.0.g80(protein)
MSKLIWKQLVFHRQEFNLENTLVNGQCFNWKKLGEDHFEGVFSEYYVQVKRTHDDYIEYC
TIPDHKIQTSQIQPQDSEKKTKKINKIEEEKKVRQQPEEEEKTSHQTQDKFLDQFKAYIN
YDIKVLDLYDHWAKRDKRFSQIAEPIHGVRCLRQDPWECTVSFICSQCNNIKRITQMLDT
LRQKYGTKICEIDQDDGSKKSIYKFPTIEQMSQVSEKELRDLKFGYRAKYLVANAKTMNE
KGGKQWLESLRGKSNEEVREQLITLNGIGNKTPMSFKLPKNQDMYKE