Identifiers and Description

Gene Model Identifier

Contig22659.0.g21

Standard Name

ODM2

Aliases

Contig22659_0_g21

Description

6-O-methylguanine DNA methyltransferase, ribonuclease-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • methylated-DNA-[protein]-cysteine S-methyltransferase activity (IEA) | GO:0003908

Biological Process

Domains

  • ( pfam02870 ) 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
  • ( pfam08678 ) Rsbr N terminal
  • ( pfam07677 ) A-macroglobulin receptor

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig22659.0.g21(coding)
ATGCTATTACAGTAACTATCAATAGATTAATTGAGACAACTGCTATCTCAAGAAAAATAG
AAAATTCAGTAATGCGAAGACGACCTCAAATAATTAGACTAGTATTTGTAAAATGTCAAA
AAGGCAATTATACAAAAATATTCATTCGGTAAACAAGGCTATAAACAAACAGAGTCATAG
AAGACTAATAATGCAGTGTGTGATTATTAAGACCAAGTATTGACTTAAATTGGTTAAAAT
ATAGTCGAATAAAGAGATTCTTAAAATAATTAGGAGGATCATGAGATGACATAAGAGGAA
GATAAATTTCAAGAGTAAAGTTTAAATAATCCAAAGCAAGATATAGAAAGTGATTTGAGC
TAAAACCATAAGATTTAAGTATCAGAGTACGACTACATTGAGATTAAAAAACTAGAGCAA
ATCCTCAAACTCAAAGAAAACTAAATTGCTTAAAATAATAGCACTTTAAACCAGCCATTT
CAGCATGCATATTCATACACATACAACGGCAAGCAGCTTTATGACAAATGCACATTGACT
CACCAATAAAATCAGTTGCTTGAATTTCATGAGAAGCAGGAAGACGATACTGGGTTGGTG
AGAAGCATGAATATTGGAAATGTGCTCCTCAGTGGCATGATGGATTAACTTCAGATTAAG
AATGAAATAGTAGAGATCAGATTGAAAAATAAGGAAATTTAGTGTGATAAAATTGAGAGA
AAACTTAAGTGA


>Contig22659.0.g21(protein)
MLLQQLSIDQLRQLLSQEKQKIQQCEDDLKQLDQYLQNVKKAIIQKYSFGKQGYKQTESQ
KTNNAVCDYQDQVLTQIGQNIVEQRDSQNNQEDHEMTQEEDKFQEQSLNNPKQDIESDLS
QNHKIQVSEYDYIEIKKLEQILKLKENQIAQNNSTLNQPFQHAYSYTYNGKQLYDKCTLT
HQQNQLLEFHEKQEDDTGLVRSMNIGNVLLSGMMDQLQIKNEIVEIRLKNKEIQCDKIER
KLK