Identifiers and Description

Gene Model Identifier

Contig474.1.g54

Standard Name

ODM1

Aliases

Contig474_1_g54

Description

6-O-methylguanine DNA methyltransferase, ribonuclease-like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

  • methylated-DNA-[protein]-cysteine S-methyltransferase activity (IEA) | GO:0003908

Biological Process

Domains

  • ( pfam02870 ) 6-O-methylguanine DNA methyltransferase, ribonuclease-like domain
  • ( pfam06667 ) Phage shock protein B

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig474.1.g54(coding)
ATGGCCGAAAAAGACCCTGATCTCGTTTAAAACCTCAAAACTATAATATAAACTCAGTAG
AAAAACATAGATCATAAAGTGTAGTTGCTGCTTGCCATCCAGCACAACATAGATTATTTG
ACAGAAATTCATGCTTAAAATTAAAGAGAACTGTGGGATACAAGTGAGATGAATAAGTAA
TTAGAACATGAAAATAATGTGCTTAAAATATAGAATTAGGGGATGAAGATACAAATAGAT
AAATATAAGCGAGATTCGGAGATGTTGATGAAGGAATAAGAAAGAATCAGGGAGCTTATA
TCAGCACAAGAAAACTCAGGTCTCCTGATAGAGACTTTAGAGTTAGCAATTTAACAAAAA
AATGACAAAGTAACAAAAATGGATTTCGATTTGACTGTGGTTCTTACTGAAAAACAAGCT
ATGAAAAAAGAAATGGATCGGTAAGATAACGAAATACGCTAATATCTGAAAGATATGAAG
GAATTGACTTTGAAGTATGATCTACTTACTGATGATAACTCAAAGAATCTCCGCCAAAAC
TCAGACTACAGGGACTTAATTATTGGGAATGAAAACAAAATGAAGCTGTACAGAGAAGAA
ATGAAGGAATAACAAAGACTATTGGAGATCAGAGATGAGCATATTGGTAAGTTGAAGGAG
GAAATTTAGGGTCTAAAAGACAGGATTAATGTACTTGAGGATATAATAGAAGAGAGTAAG
ATGGAGAAGGAAGAGCTAAGGGAAGAAAATAGGAAGATGATGATGGGAGTGGGATTGGTT
ATATCAGATGAATAGCTCAAGATTAAGTTTCAGACTCTCTCTAATGACTTTGAATTCCGT
CGAAAAGAATGGGATGCCAACGAGAATCGCCTCCTAGCACAGCTCTCCTTTTCCAAGGAA
TCTAACGAGAACCTCAAAAAGGACTACGATTTGCTACAAGAGAAGTTCGAAGCATACATG
AGAACAAACAACTAAATCAACGATACTCTCAAGAAGGATTTCGAGGAGCTCAACTCAAAA
TATCATCTGTGCAAGTTCCAGTTGGAAGATATTAGAAATGAAATGGACGAGAAGATTAAG
TAGGAAACTTCAAGGGCACAAGCAAGTGAATTACTCATGAAAGACGAGCTAGATAAGAAA
GATAAAGAGCTAGTTTAAGCATAAAATGAGCTCACAGCCATGAAAGGTGAAATAAATCTA
AAACTTACAAAACTTAAAGTTATGGAATTAGAATTAGCAAAATAGCGCATTGAAAACGAA
GATAAACTTTAGGAGTAGAAAGATCTAATGTATTAAGAATAACGAAGTGTTGGTCTTGTT
TCCACATCTTAATTAGATTTAACAGCAAGCAATAATTTACAGAATCTTGATGGAATAATC
TAAAGCAAATACGCATCGAATATGGATGTAACAAACATTCTTGGCGGAAATTTAAGTCAA
ATGAGTGTGATAAAAGAGAGAAAAAAGAAAGCTAGTGCAATGAGCATTTTAAGTATGGAT
AGATAGAAAGACTCAAAATTGGAATGA


>Contig474.1.g54(protein)
MAEKDPDLVQNLKTIIQTQQKNIDHKVQLLLAIQHNIDYLTEIHAQNQRELWDTSEMNKQ
LEHENNVLKIQNQGMKIQIDKYKRDSEMLMKEQERIRELISAQENSGLLIETLELAIQQK
NDKVTKMDFDLTVVLTEKQAMKKEMDRQDNEIRQYLKDMKELTLKYDLLTDDNSKNLRQN
SDYRDLIIGNENKMKLYREEMKEQQRLLEIRDEHIGKLKEEIQGLKDRINVLEDIIEESK
MEKEELREENRKMMMGVGLVISDEQLKIKFQTLSNDFEFRRKEWDANENRLLAQLSFSKE
SNENLKKDYDLLQEKFEAYMRTNNQINDTLKKDFEELNSKYHLCKFQLEDIRNEMDEKIK
QETSRAQASELLMKDELDKKDKELVQAQNELTAMKGEINLKLTKLKVMELELAKQRIENE
DKLQEQKDLMYQEQRSVGLVSTSQLDLTASNNLQNLDGIIQSKYASNMDVTNILGGNLSQ
MSVIKERKKKASAMSILSMDRQKDSKLE