Identifiers and Description

Gene Model Identifier

Contig12439.0.g54

Standard Name

NUC5

Aliases

Contig12439_0_g54

Description

NUC194 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12439.0.g54(coding)
ATGATTTCATTTTCAAAACTTGTTGTCATAGCTTTGGTTGCTACTTTGTCACTCTGCCAA
GACTTATTTAGAGATGCTCTAAATGACCCCGCATAATCCGCAATCATTCAAGAGTAATTG
CAAAAAGGAATGGAAGAGCAGTTGAGAAACTAAGAGAAAAATTTACAAAGTTTCCTTTAG
TTCACTCCTGATGAATACAACAAGTGCATGACCTGCGTCAATGGTTGCTGGCCATATGTT
AACTAAGGCCCTGCTCTTATAGCTTGCCAGAGAACTTGCTGGGTTGGTGCTTGCTACGCC
TACTGCCACGACAACCCAATGTCAAAGTGCCCATACACAGTTTCACAAGAATGA


>Contig12439.0.g54(protein)
MISFSKLVVIALVATLSLCQDLFRDALNDPAQSAIIQEQLQKGMEEQLRNQEKNLQSFLQ
FTPDEYNKCMTCVNGCWPYVNQGPALIACQRTCWVGACYAYCHDNPMSKCPYTVSQE