Identifiers and Description

Gene Model Identifier

Contig3262.0.g84

Standard Name

NUC3

Aliases

Contig3262_0_g84

Description

DTHCT (NUC029) region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3262.0.g84(coding)
ATGTACACTCCTAATAACAAGACTTAGATACATTACGATAATAACTAGACTTTAATGCCT
TAAATGAACTTATTTGGTACTGAGAGTATGACGCCATCAAACACAAACCAATTAAACAAC
TTCTCCGTGACTTAAAACCCAAATCAGACAAATCCAACGAAGAGAATAGTAATAAGCCGT
AAAAATATCTAAATCGAAGAGTCCAGAGTATTCGACAACAACGAAGAGATTTGCAACAAC
GATTAGTTGAAGAGAATTGAGAAACACCAGAGCAAACTCTAGCAGTTAAGAAGGTCAAAG
AATCAATCTGTAATCACTGTGAATTTCCCTACTACATCCATGAATCATGAAAATAGGAAT
AATCACACGAGGATTAATAGCAACTTATATGGGGGTGGTCAGAGTGTGCTGAGTAATTAC
AACCCTAATTCCCCAAGGAATGAAGGGAGCACGAACAATGACTTTATCAATCATACAGTC
CTCCCTAATAGTTTCATCAATCAGCCGTATCATCAGGTATTTCACATAAATGATGAAAAT
AAGATACATTCTCCATTTGAATGGGTGAGACCAAGCCTCAAGGAGGCTGAGTTAATATTG
CAACTTGAGAATAAAAAGATTGATACCAGTCAAGATCTCACCACTTAGTAAAATTACAAT
TCAAATCAGAAATTACTTACTGATAAAGGATTGAAAAATAAGGGAACAGCTTCGACTGCA
AATAATACTGTTATGAATTTAAACAATAAAACTTATAACTCTCATGTAAACACAATGACA
AGCGCAAATAACAATAACAAAATTCTTCACAGAGACATTAACGGCATAAGACATATAAAC
TTCCAGCATTTCATGCCCCAATTCACCTATAACAGTAAAAATGGTGGAAAAGCCCTAAAT
TTTGAAATTTAGAATAATCAAAATGCAAATACGAAAAATGAGATGATATCATAGAACACT
TAAAATAACAACATTAATATTTAAGAGTAGATTATGAGGGATTTATCTCAATCTAATTTC
TCATAAATACATAATGAAGTGTAGTTTTCATAGGAAGAGCAAGAAATTTATGAAAATAGA
GGAGATAGTCAGAGAGACATTAAATATTAAAATAGAGTGAAGCAGTAAAGTGTCAATATA
CCTTTGTAGTCTATTGATTCTAGGGATGAACATGATGGCTATTTTGAGAGCGATTCAAAA
CCCTATGACTAAATTGAATAAAATTAAATAATAGACATGTTTACAAATAACGATGATTAA
TACAGCGAACATCGCTTGAATTTCTTAAGAAGTAGCAACATCCTGGAAAACAATAGAGTA
TTCGACAACCTAAACACATAGCATGCCCTTCTAACATTGGCTTAGTAAAACAATCAAGTT
TCGCAGTTTCAATAATACTAGGATGCATAAATATCCAATCAACTTGAGTTTTTATCAAGA
GAAGAGAATAATCAATCATTGTTGAGCAATCACTCTTTGAAGTTGACTCTTAACTTGAAT
TAGAATAATTTAGGGGCGGACTATGGGGATTAAATAACAAGGAATAATTAGCATTTTTCA
CTTGGAGGCTCTAAAGCTAAGAAAGGCAGTAATACCAGTCATTCTCGACACCCTTAACTT
TCTTAATCGTCTAAGAAGCGAAAACGTCAATCATTTCTGTAAACAATGAAGTCAATTGAT
AGCTCTTTAAGCTAGTTCTCAGGAATAAAATCAAAAAAGTCTAAGAAAATATTTGTAAAT
GATAATAATAACGATTTGGATATTGACTTAAATGAATCATAGACATCCATTGAAATGAGA
AACAGAAGGAAAGAGACTCTTGAGGACATTTTAATGATTGGTAGAAATGGTGATGACACC
TATAGCAATCATAGAAGTATTAACAACAGATCTAACTTGTCAAGAAATTAGCTAAAAAAC
GAGAGCATTTTGCACTAAAGCCTACAATCAAACCCTAAAAACTCTACTAAGAAATTCTCA
AATAACTTACTAATGCAGAGTTATCACAAGCAATAACAGTAATTCCAGTTATAGAGGAGT
ATAGCAGATAACAGTGTGGAGGAATATGAAAATAATCTCAGATTTTAATTTGAGAAATCT
ATGGAAAGACAGAGAGACTCAACCATCACTATTAAATTCAAAGATCCTAACATGAGCAGT
CTCTCCATCAAACATGAAAGCCTGAATCAAAGCCAATTATCAAAATACAAAAAGCAAGAA
TACCTAGTAATTTAAGACTAATTCTAACAATCACAAGTTAACTCGAATAGACAAGGTTAA
ATACTATTAAGTGGAGCAATAACAAAAAAGGGAAAAGTCAGAAAACTTGAAAAAGATGGA
GATAACAAGGATATGATGCTTATTAAGCTGTAAGACTTTGATATGAGGGACGATGATTGA


>Contig3262.0.g84(protein)
MYTPNNKTQIHYDNNQTLMPQMNLFGTESMTPSNTNQLNNFSVTQNPNQTNPTKRIVISR
KNIQIEESRVFDNNEEICNNDQLKRIEKHQSKLQQLRRSKNQSVITVNFPTTSMNHENRN
NHTRINSNLYGGGQSVLSNYNPNSPRNEGSTNNDFINHTVLPNSFINQPYHQVFHINDEN
KIHSPFEWVRPSLKEAELILQLENKKIDTSQDLTTQQNYNSNQKLLTDKGLKNKGTASTA
NNTVMNLNNKTYNSHVNTMTSANNNNKILHRDINGIRHINFQHFMPQFTYNSKNGGKALN
FEIQNNQNANTKNEMISQNTQNNNINIQEQIMRDLSQSNFSQIHNEVQFSQEEQEIYENR
GDSQRDIKYQNRVKQQSVNIPLQSIDSRDEHDGYFESDSKPYDQIEQNQIIDMFTNNDDQ
YSEHRLNFLRSSNILENNRVFDNLNTQHALLTLAQQNNQVSQFQQYQDAQISNQLEFLSR
EENNQSLLSNHSLKLTLNLNQNNLGADYGDQITRNNQHFSLGGSKAKKGSNTSHSRHPQL
SQSSKKRKRQSFLQTMKSIDSSLSQFSGIKSKKSKKIFVNDNNNDLDIDLNESQTSIEMR
NRRKETLEDILMIGRNGDDTYSNHRSINNRSNLSRNQLKNESILHQSLQSNPKNSTKKFS
NNLLMQSYHKQQQQFQLQRSIADNSVEEYENNLRFQFEKSMERQRDSTITIKFKDPNMSS
LSIKHESLNQSQLSKYKKQEYLVIQDQFQQSQVNSNRQGQILLSGAITKKGKVRKLEKDG
DNKDMMLIKLQDFDMRDDD