Identifiers and Description

Gene Model Identifier

Contig16559.0.g18

Standard Name

NUC2

Aliases

Contig16559_0_g18

Description

BDHCT (NUC031) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16559.0.g18(coding)
ATGTACACTCGTGATTAAATGGAAGAGCAATTGAAAGCTCACACTAAGGCTGCAATTTTC
GAATCTCAATTCGCCTAGGCATTCGAGAAAATCTTGAGCGAAAAGAGATCTGGACAGAAC
TAAACCTATGCAGATAAGGTGAAGAGAAATGACTATACCATGACTGATGGGTATGCTGAA
GTTAAGCCATTCACTGTGGAGGGAGATGATAATAATCTCAGAGTTGCCAAATGGAATTCT
TTATTGAAGGATAGCGCATTCTACTTTGATGTACCCACTCTTTTGCAACAGAGAGAGACC
CGCAGAAAATTGCAATTGAGATATGACGATTTATTCGCAGAGACCATGAGATTCCCACTT
CAATCAAGAAGAGACTTGCTCTCATGGGCTTGCAACGCTAAGAACGAGCACTTGAAGTCC
AAAGAAGCCAGCGAGGAACTATTAGAAAACTGTGAAAATTACACTGCTCTCCTCAGAAAG
TATGGGCCAGACTATGATAAATTGAAGAATAAACTCGCACATGTTAGAGGTCTCTTCGAT
TGA


>Contig16559.0.g18(protein)
MYTRDQMEEQLKAHTKAAIFESQFAQAFEKILSEKRSGQNQTYADKVKRNDYTMTDGYAE
VKPFTVEGDDNNLRVAKWNSLLKDSAFYFDVPTLLQQRETRRKLQLRYDDLFAETMRFPL
QSRRDLLSWACNAKNEHLKSKEASEELLENCENYTALLRKYGPDYDKLKNKLAHVRGLFD