Identifiers and Description

Gene Model Identifier

Contig21910.0.g38

Standard Name

NUC1

Aliases

Contig21910_0_g38

Description

NUC194 domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • double-strand break repair via nonhomologous end joining (IEA) | GO:0006303

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002030104.0008150871967356e-141Phosphatidylinositol 3- and 4-
kinase family p...
SGDYJR066W4.001416569413617e-37TOR1 SGDID:S000003827, Chr X f
rom 559416-566828, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21910.0.g38(coding)
ATGGAGTAAAAAATTGACGAATTATTAAAGCAACTTCACAAATTCCTGTTTGCAGACAGC
GATCAAGTTGTCAATGAATTAAGAATTTATTTGCTAGATGAGTCATTAAAAGAAGCTGAA
TTGGCTTTTATCTCATCCAAGATATTTAACTCAAAATTGAGTCTGCTTGAGTTTTTGCGG
TAAAACTCTTTGCAACAAGACAAATTACTATCAAGTGTAAAGAAGAAAGTTTACGAGTTA
ATTGTTGATTATTTGAAGCTCAGATCTCAAGAAGTCAGTCCTTACCTATCTCAGATCAAG
GAAACATGCTTGTTGTCATTTAGAAGTGACACAAATAGTTTGGTCAAGGAATCAAGTTTG
CAGCTTGTAATAAAGATCATAGAAACTTATAATGTCAGAGAAATAGAAAGTCTTATCAAA
CCTAGAGATATGATGGTGATGCTTTTAGATGAAATTAAGCTCAGAAGACCCTCTGCTAGT
GTGAAAGGAACAATTTGGACTTTAGTAGGGCTTTTGCATGATAAATACGGATTGGAAGAG
TTCCGAGTTGAATCACAAGATGTAATGTTCATTTAACTTTAAGAGCAAATGAAGTCAGAA
AAGCCTGAGATCAAAGCAATTATCGGTATTATAAAGGGTCTCACGCATTCGCTTATTGGA
GAGTGTACTCTGGATGATGATCAAGTTGAGGCTTTATACAGAAGTTTGAAGATTGCTATA
CAACCCATTGAAGATATGCAACATAAAGGGGTCATGAAAGCTGCCATGAAACTACTTGGT
ACTCATATAGGAGTCTTTAAAAACTAAATTACGGCTCATTCTATTGAACTTGTGACTATA
ACACTAAAACTGTGTGTAAATGAAAACATGGAGACTAGAGACACAGCGAACGAATTGTTG
GCCCAGCTTATCCAACAGATTTCTGACGGTCTGACCAGAGATTAATCCATCCATCGGGAT
ATCTTCAGAAACATCATGCTCAAAATTCAAGAGATCCTAGATGATACCAGTCACACAAAC
GTGCTCTTGATATCTACTATTAAAGCAGTTGGAATCTTTTCAAAAGCTATCTAGACTTTC
ATGGGAGATGAGCAGTTATACAAATATCTCGAAAATCTCATTCAAGTTTCGGAAAACAAG
ATTATTAAGGAGTTTGAGCAGCAAGATGATCCAAAGAGTGACTTCAAAAATTTCAAGTAA
ATCCTCAAGAAGCAGAAGTAACTACTGTCATTCATTGAATCATATTCATACATTCTCTCA
AATTTGAAACAGGAGCCTAGCGAATCTTTCTTGTTACATTTCCATAAGGTTTGTGAGATA
GGTGTCAGACATCATCGTAAGCTCTACCCAAAGTATAGGCAGAGATTTTATGAAGCGCTT
GCTTCTTTTACTAAGGCCTTGGCTTTCCATAAAGCTCCATTCTCCTTATGGATTAAGAAA
TTTATCAGAGCCAGTTTGATCGAAACTCTCAAAATTCCTGATTCAGTGATATTTGGAGGA
GAAAGCCCATTCGATAGTTTGTAGGACTCAGTTTAATTTTGGAGAGACTGGCTTAATAAA
GATTAAATATGGTCTGATTTTACCTGTCAAATTGTATATGACGAATTGATAAGCACTCTT
ATTGAGAGAATAGAAGATCTGAATTTAACTTACAAAGTAGAAAAGGGTAAAAATATTTAA
AAGAGCAAAGATTAGGATAACAATAATGTTAATGGCAAAGCACCTCAAATAGTTAATGAA
TAATTCTAGGGTCTTCATTAAGACTACGTAGTTTCTTATATAGCTAACAATAACACTGAT
TAGCAGTTTTTAGTAAGATTATCAAACTTTGCTGAGATGTTTCTGCTTGAATCAAAGGAC
GAATGGTTTTTGAGATGGGTCCCTACTTTCTGTGGTGTAGTTATTAAGAAAGCTTCACAT
ACACCCAGAATCTCAAAACTCTACGCTCTTATGAAAGTGTGCATGTAAATTTGCAGCAAG
CATAAGTATTTCGAGGATGATCATGAGAAATTAGAAATGAATGTTGTCAAAGGAGAGAAG
TTAAACACTTATAACATGCTGCTAACCTTCTTTAAAGAGCTTATTGGCAAGCAAGAAGAA
TACTAGGATGAATTGCTAACTAGCTGCTTGGATTTATTGCTTCATGTGCCTGTGTAAATT
CTATACAGAAAAGATAAGCGCACTGATAACGTATATCTTTGGAAAAATATCATGTTTAAG
GCTTTAGATTTAGGTCGCACTAACAATCAATTAGCCATGAACAGTATTTTAATGCTTGAA
TCTTGGTTCAATTTGCTGCCAATGAATGTCACAGTGGATCTGTATTAAGACATTTTGCCA
AAGTTGAGTGATTTCTTATAAGTCGATGATAAGAAACAGAAAAAGAAGAATCAGCTAGCA
GAGACTGAGACATACTAATATCTTGAAATGTTAAAATCTGGAAATGAGGTAAATATTGAA
AGGAAAGACATAGCGTTGAAAGTACTCGATCTTCTTGGCAAGATAGGTGGTCATGCTCAT
TAAATCATTAATAATGATTAGAATAAACTCATTGAGAAGGAGAACTTTATTAAGTGGGAT
CCAGAGAAGCGACTAAAATTTACCCTTCCTCTCTACACTAAAAAGATTGATATACACTTC
GATGCTGTTTTACCTAAGCTTGTAGATCTTGCTTAAAACTCAACAGATAGAGAGACTAAA
GTTGCTTCATGCGAATTCTTACATGCCCTAGTAATTTATATGATTGGCAAAAATGCAACT
CAACCCAAGGGAAGAGCTAATAAAGACTAAGAAATAGCCCCTTTTGCCAAGATCTATCAG
AAATTATTCCCAGTTATCATAAAGTTAGCCACTGATGTAGAGAACATTTCAAGATAGCTT
TTTGAACCACTTATTTTCTAAATTGTGAGATGGTTTTCAAGTTCGAGAGTTTACGAGCAC
CCTGAAGTCGAGTCACTACTAGATGCCTTGATTGATGGAGCTTCAAGTAGAAACAACAGT
GCTCTCAGGGAGATGTGCTCAAATGCGGTTGCTGAATTCGCAAAATGGAGTTTGAAGTAA
ATGACTGATAAAGATATAAGAGACAATCCAAATAACATCAAATCTCTCATAAGAAGAATT
GAAAGCAACTCAAACCATCCAGATCCATTTAAGAGACTTTCTTCGGTTTTATGCTTCTCC
AAGATTTTCACAATCATAAGAGATTTCGATCCCTTAATAGATAGATTTTGCCTTGAGATA
GCTCACAATGTTCTTGCTTCACTAAAGATGTGTCATAATAGTCTTGAGTTTTCCCAAGAA
GTCATAGATAATTGTGCTAAAATGCTTAATAAAATCACTAAAGTTTCTTAGAAGAAAGTC
CACTTGCTCATGCTTCCAAACTAGAAGAGGTCTATTCATCCTTCAATCTTTACTTTCGTC
TTGTACATATTTGAGAAGTTTATGGCTCCAGAGACTGTGCTGAGAAAGTAATGCATGAAA
TTATGGGATGCTCTAATCAGAAACATGCCTCCTAAGAATTCTGAAGGCATGCCAGATGAC
CCAGAGAAATGGCTGTTTGACTATTATGTTTAAAAAAGAGGTGAAAAAGCCATATTCAAA
AGACTTGCGAAGATTAGTTTTGAAGATAAAAAATAAGACGAGGCTTTGAACGGCAATAAT
AACTAGAAAGCAGAGGCAAGAAAAACAATACTTTCTGAAAGATAAAAAACTCTTGATCAA
TTAACAGCCCAATTAGAATGCTTCACTTTTCTAATAGGAAAAAAGATCATAACATTTGAT
GATATGAACGAGAAACTAATAGACATGAAATTATGGATGAGCAATTTAATGTCCTTCATC
CAAGATACCATGACAAAATTAGAACTAAATTCGTAGAAGTCACTTGATAAACTTTTGATA
TGCAAAGAATACAAAGAAGCTTTGACTAAAACTAGAATTCAGCTTATTACCCAATTTTTC
AAATACCTCCTCGCCCTTGACAACAAATCACTTAAATGGCATCTAAATGAATTTGAAAGT
GGTTGTGATTTCTAAATAAGCGAATTCTGTATTTAAATCATCCTTATACCAGCAGTTCAT
TAATTACATGTACTAGTTGAAGACTAAGAGCTTGAAAGATCATTGAGAAACTATTGTGAA
TAGTTGCTTAAGAGACTTCTAGAAACCACTAACCTCAACTTACACAAAGTTCTTCATGAG
TAGATCATTCATAAGATACCAATAATCAACTTAGATAGAATAAAACCATCAAATGTAGAT
GATTATCACCCAAAGATTCTAACATCACTTGTTCTAGGGTATCTTAAATTAGCTGGCATG
GATGAGAACATTCGTGATTACTTGCTCAAGAAAAAGAGTCTTTTAGCTGTAGTAGAAGAG
TGGCTTTAAAAAGAATCTCCAATTCATAATGAATCTTCTCGTATTTTAGTTAAATTCTTG
AGTAAATTGGAAATTCCAAATGAAATTCTTTGTGAATGGCTCACTTTTAAAACTGAAGTT
TATTAGAAAACTGGGGATATCTTACTCACTTATATTGCTGATAACTGGAATCATGAGAGA
TTGGCTATTGGAAATTACTTAATTTGCAAAGCCAAAGATGAACTAAAATTATTTGGTGTA
TTCATCCCGATATTAGAAAAAGTGCATGAAAAGACTAAAAACTATCACCAATCGTTATTT
GAAACAATACCACTAGCGTGGCCTCTGAAAGAAATGGGCAAAGATTATGAAGATTTTGAG
ATTGGTAGCAATAAAATCAAAATTTATTCATTCATTGTTAATAACTGCAAAGCTTAGCTT
GCTGATAAATCTAATAAATAAGCTTAAAGCTTTTTGGATCATATTTGTGAGAATATCTAA
ATGTTTTTGAAAGAGAGATATCCAGTTCATATAAAGAAAGAGGTTCTAAATCTAGTAGGA
TTAGTTTACAACATGTCATTCCAAAAAGAATATGTTCATGAGCGATTAGACTGGAGTTTG
AGAAATTTACAATAAAATTTCTTCCCAATTAAAACAAGAGAACTCTAGAAAAACTCGAAT
GTCTGGAACAATTTCCATATTATAGTGGATGGCTTTTTGAATCTCCTACTCCTATCTAAG
AATCTGAAGGTACTAAGATTGATGTACAGAAGTATCAGAGAGCATAAAACAACGTACGAA
GCAAATTTAAAGAGAACTTTAAATATTATCATTACTCAATAGATAAACAGACAGATCCTT
CCAACTTTCAAAGATACCATAAGGTAGTTCATGGATGAATTCCTTAATAGAGATTTGGAT
AGAAGCATTGATGATAACTTGAGATGGGCAATTATGAAGAAAATCATATTGCTTATACTA
GAAACATGTGATTTGAATTATCTTGCTGAGGTTATGATTGAATATACACCCAGATTTGAG
GCAATATTGAAGAAGCCATTTAATGAAATAGCTGATTAACTTCAAGAATTTTACTTAATT
GTAAAAGAAAAGACACGTATCTTTTTAGTATTTGAGGTAATGTTCAGAAGATTGAAAGCA
GAAACCATAAAAACTTACGTTCATAAAAAGATCTATGGGGAACAATCTCAAGGCAATGAA
ATCACAAAATGGCTTATCTAAGTGTGTACTTAGTCAAAGAAAGGCCCCATTTAAGACTTC
GTCCCTCTACTCAAAGACCAAATTCAAACTGATTTTAAACTAAATAACTCACCATACTAA
GTCCAACGACAATTTATCTGTGCTTCATACGCGTGCTTAACAGCTGTGATCATGGGCACA
TAGACCAAAGAGAATCTTTTCTCACAGTTTTTGTTTGTGAGCAATAGAGATAAAGGGGAG
GAGCCACTGTGGACACTGCTGGTTGACACTCAGGAATAAGCTTATAACTTTGAAGTGGAA
ACTAACTTCAACTATGTGCAACTTAAAAATATTGAACTAAAAATTGAGGAGAGCAATTTA
AGAGACCTGAAGGATATTGCTGAGATCAAAGCCAATAACTTAATTCATGAATATGTAACA
ACTAGTTTCATGTCTTCAAATGAAAAATTCAACTCAGCCATGGTATTTGAAACTCAACCA
GATAAAATTAACATGAAGAGTGAGGAAGAAAAGTTGCAAAAATTAATTAATCGTAAGTAG
GAAGCTTCAGAAATTCAAAGAGACAGCAATAGCTAATCTCAAGGGGATCTCATTGGTATA
AACGACAAAGAAAATCAAATAGAGGAGTCACTTGAGTTAGAGTTAGACAACGTAAATAAA
CACGAATGCATGAAAAACATCAAGAGATGCATTGATAAAATGAGAGAGCTCTTCCAACCA
TAATGGGAGTAAGACAAAGCCAACATGCCCTTATTTATGCAAAGCTTGAACTCAGAGATT
CGCAAGCCAGATATCCACTTAAATGTCAAAATATTCATACTCAAGATCCTTATCAATCAT
CCATAATTGTTTCAGCCATATGCTCAATACTGGTTTGAACCCATTGCTAACTACATTTGT
GATAAGAATAATGGCGGCAAGGGTTTCCATTATTTCATGAGAGATCTATGCACAATGTTA
ATATCTTGGAATTACATCCCTGAAGAAAACAACTAAAACAGGTTATTATGCACAAATGTG
GTAAATACCTTGATTAAGTACGCAGCTGACAAGACTAAAATGATCTTTAACACTAATATT
TAAATCATCGCTGGATTGCTGCATAGATGGAGGAAACTAGTTGCCATAAATAAAGACATG
GTAAGCATGATGGTAGGCATGGACGATAAAAAAGAAGGCAGTAATTTGTGGAAGATGACT
GGCATTCAGATATTGGCTCTCACAGTCTCTTTTGACATCCCAATCATTGAAAACCCTCAA
AACATCAATAACTTGGCACCCAATCAAAGACAGTTCTAACTTGAAGAGAGGCCAGACAGC
GTGGACAAACTTCTTAACAATCTACTGAAAATACAATCTAGTAAGAAAAAGCAGATTATT
TAAGCTGCCAGTGAGACACTTGGAAAAATATTGGCCAAGCAGCCAAGTCTCCTGAAATAC
TCAATTAGCTCCATAATTGAAAATGAGGAGAGGGAAAGACACGATGTTCTAGTAAACACT
ATCGAGAAAATATCAAGGGAATTTCCTTAATTGTTAGATGATAGAAGGATTTTCATGAAA
TTGCTCTCTTTCGTTAAAGTCTTAACTGGTACCATGAGGAGTGCAATTTTAAAGTCATTC
GAGAGATACATAAATCTGTGTCGTTAAAGAAAGGAAAGAAACGACATCGATTAAATCACA
CTTTCCCTCTAAGCAGACTCAGACGACATCCTAGCTGATATTTCAGATGAAAACTAACAA
TCTTTCCTGTAAATAGTTACATAAATAGCAAAGATTAACACAGAATAAGGTGATAAACTT
CTCATGAAGATACTACCCAGACTCAAACAACTGTTTGTGTCGAATAAAAATGATTATAGC
AGGGGGTTGTTCTACGATTTGATGGTATTCATGTACGATCAGTATGATGAAGGGTTTAAA
CAAATGGTCAAGAGTGCTTTGATAAGAGGATTAAGTGATAAGAGCAAGCTTGTTAGAGAG
AAGCTCTATGGGTTCTGGAGTGACCCAGCAAGACTAGAGTTAGATCCAAACACAAGGCTC
TAGCAAATAATGGAATAGCTCTACACTTAAGAAGAGGAAGCCATTTGGCTTAATAACTCA
GTGTATCTTCTAATGTCAATCACCAATAAGTCATCAGATTTTGAGAGAAAGATATTCGAC
CAACCCTTGTAAAACTGCAAATTCCATCCCTTGGAAATCAATCAATTTGGGCACAATCTC
AACAGATCTCAACCCTTGACACCACTCTTCTCTCAAATGGATTAAGTATTCCAAGCAAGT
TAGGCATAATTTCAGTAGTAAAGAGAACAGCAATTAGCTGTAATCTAGGAAGTTGAAAAT
GAAAATATAGATGAAAATGGAAGTTAGCTAAATCAAGGAAGATAAGATGTTCAAATGATT
GATACAACTACTGCAGCTAATTCAAATAAGGGAAGATAGATGCAATAGTCATAGCAGAGA
GGGAGATAGTCCTCTACATCGATCAATTCATCACAGTTCAACCCATCTTAAATAGTCGAG
GAAATAAGCGATAGTTAGTTTTATCAAAATAATGTTCTCAGAGCTACTTAGATTCCACAG
TTTACCCAGACTTAGAGTGATCAATCATTTTTGATAGCTTCTACTTTCATGTAAAATCAG
TAGTAATCATCAAATTCTCCTCCAATTACTGACTCAATTTCTGCCTCTTTCTATGAGATT
AACAGACTTCATAAAAACTAAAACTAAAAACAGCGCGGAACATCTTAAGTTTTTCAAATA
AAAACTGGAAGTCAAGGCAGTCAAGATCGTAATGACATGGATGATGAAGGATTCTTAATG
CCCACAGCTAGAAAGAAGGGAGGAAACCATTTAGGAAAGTTCTTCAGTCAGAATTAATTT
GTCTATAAACCTTAAGAATCACAGGGTCAAAGAATCAGATATGTACCCTAAGGCTCTATG
CCCTTGCATCTGGCAAGATAAGAAGAAGTTAGAAATATGTAGAGAGAATAGTATCTAAAT
CGCCAGAGAGATAGGATGAAGAAATAAGTTGGCTTGTACAGAAAGTATAGAGTAGGTGAA
TTGCCAGACATTTAGATCAATTATAAGGATCTATTGTTGCCACTATCTGCTATGATCAAG
AATGATACAACGATTGCAACTGAAATATTCGTCGAAGTTTTTGGAGAGCTCTATAAATCT
CTAAATGATGAGCAGCTTAGAGAGCAATTAGGTAAAGGTGTCCGTTCAGTTCTCAGTTAA
TCTATAATTTACGATTATGGTTGCATAAACTGCATGCATAGAGTTGCAATGGAACTATTA
AAAACAGATGGTTTCACTGTATCAGCAGAAATAATTTAAAGAACAGGTTAGCATTCTATG
TCATATTAAACAGCTCTTGCTTTGATTGAAGAATCTATTATTCATGGTAAAGACATTCAT
GATGCCCAATTCTAACAAGCAAGCTAGCAACAAAAGAGGAAAAAGTAAGAACAATCAAAT
AGTTAGAACTCTCGTAAGGGAGGAGCTAGAAATTTTACTTTTACACAAGTAAGCGATGGA
AACAGAAAATACTGGTTCAATATGATTGATCTTTATGAACAGATTGGAAATAATGATGCT
CTTTAAGGAATTTGGTCCTTTTTAGCAGATGAAGAAGGTATCATATTTAAGAATAAGGAC
GACTAAGGAATATTTAGTTAGGACTAAGACACTACTGTTAACCTAATAAAGCAAGCTCAG
TCTCTTAGATTAAAAGGTTAAATTAATGAAGGTATGAAAATTCTAGAAAAAGCTCTGGAA
GATCCAAAGTTAACAGAAATTCTCGAAGATCACATTAAAATAGAGCTTTAAAATAAAAGA
CTAGATTCTAAAGCAGAACTTCTAAAATGGGATGAAATCGCGAGTGAGCTAACAACAACT
TACAAACACTAAAAACTTCAAGATATCCCTTTTGCTCATGCAGAGAAGATGATTAAAGCT
CAAATAAGAACAGATGAATATTGGGTTAACTTGAATAGATAGATTGAAATATGGCAACAT
GACTCAGTTTCAAAGGCCTACTTAGACAAAAATTTCAACTTTGAATTGGCTTTGAATTCT
TTAACATGCAAGGACTATGATCGTGCAAGATTTTACCTTGATAAAGAAACCAATGAGCTG
CTTACTCAGTGGAAAAATCTTACTAAACTTTCTTAAGTTTCTTAACACATCCTGGTTTAA
AGAATCTAAAAACTTTATGAAATGAGAGAGTTTTTGAGTATAATCAAGTCAGAAACCATT
ATTTCCAAGGATGATCTCATTCCTTAAGTAGTGAGATCGATACAACACTGGATCTAGAGA
GTGCCTAGTTATGCCTTCGATCATTTAAGCGTCTGGGATGATATTCTAACTTCAAGAAAC
CTTTATTTAGATCTTTATAATTTCAGGCTTAAGCAAGGCTTGAAAGATCAACTTAACCAG
AAGAAAGACTTAATTGATATAAGCGCTATTCTGTAGGTTTAATGCGCTAAGGGTTCTTTT
AAAATGGGTTTATATGACTCCTCAGATCGATTTTTAAAGCGAGCTTTGAATCTCAGAGGT
GACAACGCTGGTAATGCAGCTTCTAATATGAAAATTGTTGGACCAATCATTAAACTTAAG
AGTCAATAATTCAAGACAGACACTATGAATGAAGATTACATAGGAAAGACCAAGAAGTTG
CAAAAAATCCTAAATGTGCTGGATAGCAAGATGAAGAGTGTATTTGATAAACAAAATCAG
GAAAATCGTGGTGAAGATATCAAAACTGAAATTAAGAGTTTACTCTTGAGATAGAGGCTT
GAGAAGAAAATGCTCAATATTATCTTAGAAGGAGTGCAAATTGAGCAAGGTGGCCAAGAT
AAAGAACTAGAAGATAATTGTTCAGTATATTTAGGGAAATCATTTGATACACTTGGCAAA
GTTATTGAGAAGGTTAAAACAGCTGCTCAGTATGACGATCAAATGAAAAACACAATGGCA
AAGACTTACTTTAAATTTGCTTAATTTTCAGATAAGATCCTACGTAAGATGGAAATCGAC
ACTTGTCAAGGAGTAATCAAGAGAAGTCTTCACAAAGTAAAGAAAACAGAGGAAGAAGTA
GCAAGATAGTCAATCAGGTATGGTCTTCAATCACTAAATCTAGAATATTAAAAAGCTTCA
GATATCATTCCTCGACTTCTAGATATTGTCAGTAAATACAAGGAAAATGTAGAGGGAGAA
TTCATTGCACATTCTAAAGACACTCCCGCATGGTTCTTCCTAAGATGGATAAACTAGATA
GTTGCAGTTATTAACCGTTAAGAATCCTCAGTCATCGAAGAAAAGGTAGTCTAAATAGCA
AAGAGGTATCCTCAAGCCCTATTCTATCCCTTTAAAGTTATTGAAAGCAATATCTAAGTA
AACGTCCTAGATGCAGACATACAGAAGACTCATCTTTTCTCAAAACTGAGCACATTCTTT
AAGAAATCCTTCAAAAACTTAAATGCTTGGATTGAAGCGTTGGACTGTTTAGTATATCCT
GAACACAGATACAAGTACTGGTCTTAAATTCTAAGCGATTTGCTTAGTGATGGAGAAGAT
AATATTAAACAAGTTCCCAAGGGCAAGTTGAAGGAAATTGTACAATTTATGATGCAAGAT
TTAGTTAGTCCAGAGAAGGAACTAGTAGGTGATCAGATTGGTTCTTATAACAGAAAGTTC
GCCGAGAAATGGGAAAAGTAATTTATCAAGTGCTTTGGTAAAGATGCCTCAAACGTTGAA
AAACTATCTCATAAGCAACTATCACAGTTAATGACTTAGTTTAGTTAGAAAATGAATGAA
TCAATGGGCACTTTAGGTCAAGGCTATGAAAAAGTCTCTACCTTTAGTGAATGGCTTGAT
TGTCTTGACATCAATGATTTTTACAATCCTTATGAATATATTGAGTTGCCAGGTCAATAT
GAAGGATTGAGAGCAGAACCATTAGTTGAAAAGAATGTCAAGATAGCAAGTGTTAGAAAG
TCTCTATTAACTCTAGGTTCAATAAGAAGACCAAAGCGTTTAACAGTGCATGGCTCAAAT
GAAAAAGATTATCATTTGCTAGTTAAAGGTGGTGAAGATTTAAGACTTGATCAAAGAGTC
CAGTAACTATTCCAAATCATGAACAGCATTTTTAAGGATGATGCTTAATGTTAAAATAGA
GATCTATACATAAAAACCTTTAATGTTGTGCCAATCACAAACAGACTTGGAGTTTTAGAG
TGGGTAGACAACACAGAGCCAATGAAAAATATAGTTAACAGAGAACACATGAGAGTTGAA
GGAGGCAAGGATCTTAACCAAAGTAAAGCATTAGCAGATAGAAGAAAATGGTTGAAAAGC
CATGTACCAGGTAATGCTAAGAAGGATAATATTGCAGAGTAGCATTTGTAATTACTTGGA
TGTGATGAGAAAATTGTGATCGATGGTTATAATAAACATAAAGATGCCATGCCTTGGTTC
TTGTTAAGAAATGGTCTAGAAAACCTCTGTTTAACTTCTTCAGCATTTTTGTCTATTAAA
AACTAATTTACAAAATCACTTGCAACCTTCTCAATTGCTTCTTACTTGATTGGTATTGGT
GATAGACATTTAGAGAATTTTCTAATTGATACATCTGATGGTGAGATTCTTGGTATTGAT
TTTGGAATAGCCTTCGGTAGTGGTGTTCAGCTTGGTATTCCTGAACTTATGCCATTTAGA
TTAACATAGCAAATCGAAGGTGTAATTGCTCCACATCCTCTTGAAGGAGTTTATAAATAG
ACTATGGTCCATGTTTTAACAGCATTAAGAAAACGAAAGAGTCTGATTATGGATACTTGT
GAGATATTTGTCAAAGAACCACTCCTTGATTGGGTGAAAGATGCAAAATCAAAGCAAAAG
GCTTCAAATAACGATAGTAATCAAAATGAAAATGGAGGCGTGGTAGATTCACTAATTTCA
GAGTACGAAGAAGAACTTCAGGAATTAGCTTGGTATCCAAGAAAGAAAATTGAAATAGTG
AAAGATAAACTGCATGGTCTAAATCCAGTTAAAATTCTAGCTAAGGAACTTAAAGACTCC
AAGCATGAAAAGAGACAGTATATCAAAACCATTCTAAGAGCCATTGAGGGTCCTGAAGAT
TCATAGAGACATAAACTACTGAGAGCAAGAGACAAGAAGAAATATCTAGATGTTAGTGAA
TTTGTTGACTGCTTAATTGAATAAGCTAGAGATCCAAATATTTTGGGTAGAACTTGGATA
GGTTGGAGTCCCTATGTTTGA


>Contig21910.0.g38(protein)
MEQKIDELLKQLHKFLFADSDQVVNELRIYLLDESLKEAELAFISSKIFNSKLSLLEFLR
QNSLQQDKLLSSVKKKVYELIVDYLKLRSQEVSPYLSQIKETCLLSFRSDTNSLVKESSL
QLVIKIIETYNVREIESLIKPRDMMVMLLDEIKLRRPSASVKGTIWTLVGLLHDKYGLEE
FRVESQDVMFIQLQEQMKSEKPEIKAIIGIIKGLTHSLIGECTLDDDQVEALYRSLKIAI
QPIEDMQHKGVMKAAMKLLGTHIGVFKNQITAHSIELVTITLKLCVNENMETRDTANELL
AQLIQQISDGLTRDQSIHRDIFRNIMLKIQEILDDTSHTNVLLISTIKAVGIFSKAIQTF
MGDEQLYKYLENLIQVSENKIIKEFEQQDDPKSDFKNFKQILKKQKQLLSFIESYSYILS
NLKQEPSESFLLHFHKVCEIGVRHHRKLYPKYRQRFYEALASFTKALAFHKAPFSLWIKK
FIRASLIETLKIPDSVIFGGESPFDSLQDSVQFWRDWLNKDQIWSDFTCQIVYDELISTL
IERIEDLNLTYKVEKGKNIQKSKDQDNNNVNGKAPQIVNEQFQGLHQDYVVSYIANNNTD
QQFLVRLSNFAEMFLLESKDEWFLRWVPTFCGVVIKKASHTPRISKLYALMKVCMQICSK
HKYFEDDHEKLEMNVVKGEKLNTYNMLLTFFKELIGKQEEYQDELLTSCLDLLLHVPVQI
LYRKDKRTDNVYLWKNIMFKALDLGRTNNQLAMNSILMLESWFNLLPMNVTVDLYQDILP
KLSDFLQVDDKKQKKKNQLAETETYQYLEMLKSGNEVNIERKDIALKVLDLLGKIGGHAH
QIINNDQNKLIEKENFIKWDPEKRLKFTLPLYTKKIDIHFDAVLPKLVDLAQNSTDRETK
VASCEFLHALVIYMIGKNATQPKGRANKDQEIAPFAKIYQKLFPVIIKLATDVENISRQL
FEPLIFQIVRWFSSSRVYEHPEVESLLDALIDGASSRNNSALREMCSNAVAEFAKWSLKQ
MTDKDIRDNPNNIKSLIRRIESNSNHPDPFKRLSSVLCFSKIFTIIRDFDPLIDRFCLEI
AHNVLASLKMCHNSLEFSQEVIDNCAKMLNKITKVSQKKVHLLMLPNQKRSIHPSIFTFV
LYIFEKFMAPETVLRKQCMKLWDALIRNMPPKNSEGMPDDPEKWLFDYYVQKRGEKAIFK
RLAKISFEDKKQDEALNGNNNQKAEARKTILSERQKTLDQLTAQLECFTFLIGKKIITFD
DMNEKLIDMKLWMSNLMSFIQDTMTKLELNSQKSLDKLLICKEYKEALTKTRIQLITQFF
KYLLALDNKSLKWHLNEFESGCDFQISEFCIQIILIPAVHQLHVLVEDQELERSLRNYCE
QLLKRLLETTNLNLHKVLHEQIIHKIPIINLDRIKPSNVDDYHPKILTSLVLGYLKLAGM
DENIRDYLLKKKSLLAVVEEWLQKESPIHNESSRILVKFLSKLEIPNEILCEWLTFKTEV
YQKTGDILLTYIADNWNHERLAIGNYLICKAKDELKLFGVFIPILEKVHEKTKNYHQSLF
ETIPLAWPLKEMGKDYEDFEIGSNKIKIYSFIVNNCKAQLADKSNKQAQSFLDHICENIQ
MFLKERYPVHIKKEVLNLVGLVYNMSFQKEYVHERLDWSLRNLQQNFFPIKTRELQKNSN
VWNNFHIIVDGFLNLLLLSKNLKVLRLMYRSIREHKTTYEANLKRTLNIIITQQINRQIL
PTFKDTIRQFMDEFLNRDLDRSIDDNLRWAIMKKIILLILETCDLNYLAEVMIEYTPRFE
AILKKPFNEIADQLQEFYLIVKEKTRIFLVFEVMFRRLKAETIKTYVHKKIYGEQSQGNE
ITKWLIQVCTQSKKGPIQDFVPLLKDQIQTDFKLNNSPYQVQRQFICASYACLTAVIMGT
QTKENLFSQFLFVSNRDKGEEPLWTLLVDTQEQAYNFEVETNFNYVQLKNIELKIEESNL
RDLKDIAEIKANNLIHEYVTTSFMSSNEKFNSAMVFETQPDKINMKSEEEKLQKLINRKQ
EASEIQRDSNSQSQGDLIGINDKENQIEESLELELDNVNKHECMKNIKRCIDKMRELFQP
QWEQDKANMPLFMQSLNSEIRKPDIHLNVKIFILKILINHPQLFQPYAQYWFEPIANYIC
DKNNGGKGFHYFMRDLCTMLISWNYIPEENNQNRLLCTNVVNTLIKYAADKTKMIFNTNI
QIIAGLLHRWRKLVAINKDMVSMMVGMDDKKEGSNLWKMTGIQILALTVSFDIPIIENPQ
NINNLAPNQRQFQLEERPDSVDKLLNNLLKIQSSKKKQIIQAASETLGKILAKQPSLLKY
SISSIIENEERERHDVLVNTIEKISREFPQLLDDRRIFMKLLSFVKVLTGTMRSAILKSF
ERYINLCRQRKERNDIDQITLSLQADSDDILADISDENQQSFLQIVTQIAKINTEQGDKL
LMKILPRLKQLFVSNKNDYSRGLFYDLMVFMYDQYDEGFKQMVKSALIRGLSDKSKLVRE
KLYGFWSDPARLELDPNTRLQQIMEQLYTQEEEAIWLNNSVYLLMSITNKSSDFERKIFD
QPLQNCKFHPLEINQFGHNLNRSQPLTPLFSQMDQVFQASQAQFQQQREQQLAVIQEVEN
ENIDENGSQLNQGRQDVQMIDTTTAANSNKGRQMQQSQQRGRQSSTSINSSQFNPSQIVE
EISDSQFYQNNVLRATQIPQFTQTQSDQSFLIASTFMQNQQQSSNSPPITDSISASFYEI
NRLHKNQNQKQRGTSQVFQIKTGSQGSQDRNDMDDEGFLMPTARKKGGNHLGKFFSQNQF
VYKPQESQGQRIRYVPQGSMPLHLARQEEVRNMQREQYLNRQRDRMKKQVGLYRKYRVGE
LPDIQINYKDLLLPLSAMIKNDTTIATEIFVEVFGELYKSLNDEQLREQLGKGVRSVLSQ
SIIYDYGCINCMHRVAMELLKTDGFTVSAEIIQRTGQHSMSYQTALALIEESIIHGKDIH
DAQFQQASQQQKRKKQEQSNSQNSRKGGARNFTFTQVSDGNRKYWFNMIDLYEQIGNNDA
LQGIWSFLADEEGIIFKNKDDQGIFSQDQDTTVNLIKQAQSLRLKGQINEGMKILEKALE
DPKLTEILEDHIKIELQNKRLDSKAELLKWDEIASELTTTYKHQKLQDIPFAHAEKMIKA
QIRTDEYWVNLNRQIEIWQHDSVSKAYLDKNFNFELALNSLTCKDYDRARFYLDKETNEL
LTQWKNLTKLSQVSQHILVQRIQKLYEMREFLSIIKSETIISKDDLIPQVVRSIQHWIQR
VPSYAFDHLSVWDDILTSRNLYLDLYNFRLKQGLKDQLNQKKDLIDISAILQVQCAKGSF
KMGLYDSSDRFLKRALNLRGDNAGNAASNMKIVGPIIKLKSQQFKTDTMNEDYIGKTKKL
QKILNVLDSKMKSVFDKQNQENRGEDIKTEIKSLLLRQRLEKKMLNIILEGVQIEQGGQD
KELEDNCSVYLGKSFDTLGKVIEKVKTAAQYDDQMKNTMAKTYFKFAQFSDKILRKMEID
TCQGVIKRSLHKVKKTEEEVARQSIRYGLQSLNLEYQKASDIIPRLLDIVSKYKENVEGE
FIAHSKDTPAWFFLRWINQIVAVINRQESSVIEEKVVQIAKRYPQALFYPFKVIESNIQV
NVLDADIQKTHLFSKLSTFFKKSFKNLNAWIEALDCLVYPEHRYKYWSQILSDLLSDGED
NIKQVPKGKLKEIVQFMMQDLVSPEKELVGDQIGSYNRKFAEKWEKQFIKCFGKDASNVE
KLSHKQLSQLMTQFSQKMNESMGTLGQGYEKVSTFSEWLDCLDINDFYNPYEYIELPGQY
EGLRAEPLVEKNVKIASVRKSLLTLGSIRRPKRLTVHGSNEKDYHLLVKGGEDLRLDQRV
QQLFQIMNSIFKDDAQCQNRDLYIKTFNVVPITNRLGVLEWVDNTEPMKNIVNREHMRVE
GGKDLNQSKALADRRKWLKSHVPGNAKKDNIAEQHLQLLGCDEKIVIDGYNKHKDAMPWF
LLRNGLENLCLTSSAFLSIKNQFTKSLATFSIASYLIGIGDRHLENFLIDTSDGEILGID
FGIAFGSGVQLGIPELMPFRLTQQIEGVIAPHPLEGVYKQTMVHVLTALRKRKSLIMDTC
EIFVKEPLLDWVKDAKSKQKASNNDSNQNENGGVVDSLISEYEEELQELAWYPRKKIEIV
KDKLHGLNPVKILAKELKDSKHEKRQYIKTILRAIEGPEDSQRHKLLRARDKKKYLDVSE
FVDCLIEQARDPNILGRTWIGWSPYV