Identifiers and Description

Gene Model Identifier

Contig21456.0.g86

Standard Name

NUBP1

Aliases

Contig21456_0_g86

Description

ParA/MinD ATPase like

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003122209.99838497179609e-146nucleotide binding protein 2,
putative
SGDYGL091C4.998015698166016e-118NBP35 SGDID:S000003059, Chr VI
I from 343042-342056, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21456.0.g86(coding)
ATGGATAGTAGCACTTAATAACAAGAGCAGCAACCAAAGACTGAAAAAGTCCCAGATAAC
GCTAATGAGCACTGCCCAGGGGTTGGAACTGAAAAATCAGGGAAGTCAGAGGCTTGCGCT
GGATGCCCAAATCAAAATGTATGTGCAAGTGGTCAGGCTCAACAGGAAGATCCAGCACTT
GAGGAAATCTCTTAAAAACTTGGCTAGGTTAAGAATGTGATTTTAGTTCTATCTGGAAAG
GGTGGTGTCGGTAAATCTACAGTCTCAACTCAATTAGCGCTAACTTTAGCTCAAGATGAA
AATGTTCAAGTTGGTCTCTTAGATATCGATATTTGTGGACCAAGTGTGCCTAGGATGCTT
GGACTTGAAGGTTAAGAAGTTCACTAGAGCAACTAAGGATGGTCTCCAGTATACTTCGAA
GATAACTTAGCTGTGATGAGTATTGGTTTCCTTCTCCCATCAAAAGATGACGCAATTATT
TGGAGAGGTCCTAGAAAGAATGGGTTGATTAAGTAATTCCTGACTGATGTTATTTGGGAA
GATTTGGACTATTTGATCATTGACACACCACCAGGCACTTCAGATGAGCATATTAGTGTT
GTTCAGTACTTGAAGAAGACTCATATTCTTGGTTCTGTGATTGTTACCACCCCTCAAGAA
GTAAGTTTGAGTGATGTGAGAAAAGAAATAAATTTCTGCAAGAAAACCGAATTGCCAGTC
ATCGGAGTAGTTGAAAACATGAGTGGCTTCGTTTGCCCTCACTGTGATTGTGAAAGTCAA
ATATTCCCACCAGTGACAGGAGGAGCCACTAAAATGTGCGAAGATATGAATGTGAAACTT
TTGGCCTAAGTGCCCTTGGAACCTAAGTTATTACTCTCTTGTGAAAAAGGCAAGTGCTTT
GTCGAAGAGCACCCTCAAACCAAGACTGCTAAATAATTCAATTCTTTAGTTGAATAGATC
AAATTAGTTGCAAGAAAGTGA


>Contig21456.0.g86(protein)
MDSSTQQQEQQPKTEKVPDNANEHCPGVGTEKSGKSEACAGCPNQNVCASGQAQQEDPAL
EEISQKLGQVKNVILVLSGKGGVGKSTVSTQLALTLAQDENVQVGLLDIDICGPSVPRML
GLEGQEVHQSNQGWSPVYFEDNLAVMSIGFLLPSKDDAIIWRGPRKNGLIKQFLTDVIWE
DLDYLIIDTPPGTSDEHISVVQYLKKTHILGSVIVTTPQEVSLSDVRKEINFCKKTELPV
IGVVENMSGFVCPHCDCESQIFPPVTGGATKMCEDMNVKLLAQVPLEPKLLLSCEKGKCF
VEEHPQTKTAKQFNSLVEQIKLVARK