Identifiers and Description

Gene Model Identifier

Contig9803.0.g46

Standard Name

NTO1f

Aliases

Contig9803_0_g46

Description

PHD-zinc-finger like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR031W9.000561397357242e-21NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...
T. thermophilaTTHERM_004447000.00000000019994075865167896PHD-finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9803.0.g46(coding)
ATGAATAAACACAACTCTCAATAATCAGTAGCCGCTCACAACCTACCTTCCAAATTGGTC
AATATGCATGCAAAGGGAGGAGGAGGTTCTCACCTTGATTATAGCTCAGGTTTAAGCGTT
CTTTAAAGCAGTCAAATCTAATAAAATGGAAAATTTGAAAATCAGAAAAACTTTGGAGAA
GAGGCATCATCATAAATGAATCTTAATTCAGTGAGCTAACTCAATCTATTAGCCTCAAAC
TAGTCAGACGATTTGGATTGTATGGAGTAAATACATGGAAAATAACAAAGAAATGATAGC
AACGAACCTGTGAATAACAAAAGACAAAGGACCTAAGACTCCTCGAATCAAAACACCCAA
CAACTAGATTCTGTTGAGGACTTTCTGCTTGACGAAGACGATGTGGCAGCTTTGCAAAGT
GACATGCAGCTTGAAGACTCTTTAATTGATAAAGACTCCCAATCTTAATTTGCTTTGAAC
ATTCAGAACTCTCAATCCCTCCTCATGAGACTATAAAACGAGAGATAACTAAATGACTAC
TCAGAGTATGAAGAGAATGAGAAAAGTTTGAGAGGGAATAAGAAATGTCAACCTCTTGGG
TTTATAAACTCTCAAAGTGATGCAAGTGGAATGAGCTTCAGCGGTAGCGGCGGTGAGTCT
TAGGTATTTATTAATCTTGAATGTGAAAGCTAGCCAGAGATATCATCAGGAATGATAGAT
TCATCACATACCCTTAGTCAGAGAGATACAAAAGAAACAAAAGATTTTGATTCAGATGTA
ACTAAGGATTTAGGAGTATCCTAGGCACAAAAAGTGGGGAAGAATTGTAAGCCTAAACAA
AACTAAGCGATCAAATCTTCTTAAAATTAGACTGAAACCAAAACTCAAAAATCAAAATCA
AAGATTAAGAAGAACTAAGCTCAGGACGAGTCAATGTCAGACGCCAGTTTCTCTCAAACT
CAATTAATATAGCAACAACCCATCAACTCTCGTGCTTCAAAAATAAAATAAAAAGACCTT
AATGATTTAGAGGAAGAGAAGGTTTCTTAAAGTCAACTCATAAATAACGATATAAACAGC
AAATAAATTCAAGCACATAAGAATTTGAATGACTTTAAGAAAAGTAATTCTTCTTGCATC
GACTCATAATTACCCAGATAAAATTTGTTGAAAATGAGTTCAGATAGTCAAGAATTTAAG
CAAGAAATTCTTAGAATGAGGAGTAAGTTCGAAAGTGTCATAATGACTGAAAATCAGGAT
GAAGATTTGTGGAATTGCGATATATGTTTATCTAAAGAAGATGAAGAGGATGACCCACTC
TATCAGTGTGATCTATGCATGGTGGTAGTTCATCCGGCTTGCTATAGAAGAGACCTCTAC
GATGAGGTTATGCAGAATTCTGATTGTGAAGATGAGCCATGGTTTTGTGCAAGATGCAAA
CATTTGATTAATGAGTAACCGCCAGCAAATAAGTTGCCTAACTGTTTCTTATGTACTGAC
TTATTAGGCTCTATGATAGATCTAGACTCAAAAGAGTGGGTGCACCAAAGCTGTGTGAAC
TGGCATGATGATATCTGGTTTAATGAAAAAGACACTAAGTATCGTAAATTCGAGGGAAAA
CTTGATTATGAGAGATTTAGTTTGACATGCTATATTTGCAATATTAAACAAGGTGCATGT
ATTCAATGTGATCTCAAAAGCTGCCAGAAAGCTTTTCATGTGAGATGTGCAATTAAGGAG
AGATTGATAGTAAGCACTGAAGAAATGGAAGATTTGAGACTTGGAAGTTGGGACGTCAAG
ATATTCTGCGGGAAACATACTAACATAGGAAAAAAGAAAGTTTAGAAGATACAGCTTTAA
AAGTTCTTGTCAACAAACTGCAATAAAGATGTAGCAAAATTAATCTCCTTAGATGATTAA
GAAAGTGAGCAAGACAGAGTTACTAGAAGACAAGCTATGATAATGGCTAATCAGTAGCAG
CAGCAGCAGAGGAAGCGGAAATCTGTGATAAATGAAATCGATATAGATAAAATCATGGAA
GATGACTTTGAAAAGGTTCAATCTCCTCCTAAAAATCTGTTGTTAAATCCTACGCCTAAC
ATTCCTAAGTATTTGGATAGCAAGATTAATATTATTGGGATCGATAGAAATGTCAGTGGA
CTAGCTTCAATTTCATGTGAAGTGCAGCAATAAATTCCGAAGTAAGAAGATAAACAACAG
TAGTAGAGATCTGCCAGCAACAAAGCCAGAAGATCAAATAATGGTTTTGTTCCAGACTTT
TCTAAGTGTGAAGTCATAAGACCAGGTGGACTAGCTTAAGAGTCCACTTCTGATATTCAA
AAGAAACCACTTGCTCAAAACCCTCTTATTAAACCAAAATAAAATCCATCATCTGGTAAT
AATTAGATAACGAATAGTACAGCTTAAGCTTCACTTCAAGCTAAACCTTTGATTACTCAG
AACGACTTCCTTCCAAAACAACAGATTCAAGTTATAAATCCTAATGAGCAGTAGTAGTAA
CAAACTTCAGGGGGTGCGAGTAGACTATCGTCAACTGGTTTCCTAAGTACCAAACCAAGA
CCTTTGCCAAATCCTTCTTCAAATATTCAATCTTTCCTTGGTGCAGATCCCAGACTCTAA
GTCTCATCAAATTAGCAGGCTGATAATGTTGTAAGCAAACCATCAGGCTTTTTAGATGTT
TAAAAATCTGCAAAAAATCAAGTTAAATCAGCTGAGTTAAACTTAGAGAGCATCAATACT
GAGAATCCTCATAAGTTCAAGATAAACAAGAAGCTATAAGATATCCTTAGAATACCTGAA
TAGAGAGTTACTTACAAAGATTTTACACTTGCCTTGTTCAGATTCCATAAACAAGTTGGA
AACTTCTATGACAAGCCCACATCGACTTTTGATCTATCAAAGTACCCGTAATTTAGAGTA
TTCTGGCCCAATCACTCAAGAATTGGCTAGGATGACATTAAGAGATATCTCCTTGGATTG
CAAATATGA


>Contig9803.0.g46(protein)
MNKHNSQQSVAAHNLPSKLVNMHAKGGGGSHLDYSSGLSVLQSSQIQQNGKFENQKNFGE
EASSQMNLNSVSQLNLLASNQSDDLDCMEQIHGKQQRNDSNEPVNNKRQRTQDSSNQNTQ
QLDSVEDFLLDEDDVAALQSDMQLEDSLIDKDSQSQFALNIQNSQSLLMRLQNERQLNDY
SEYEENEKSLRGNKKCQPLGFINSQSDASGMSFSGSGGESQVFINLECESQPEISSGMID
SSHTLSQRDTKETKDFDSDVTKDLGVSQAQKVGKNCKPKQNQAIKSSQNQTETKTQKSKS
KIKKNQAQDESMSDASFSQTQLIQQQPINSRASKIKQKDLNDLEEEKVSQSQLINNDINS
KQIQAHKNLNDFKKSNSSCIDSQLPRQNLLKMSSDSQEFKQEILRMRSKFESVIMTENQD
EDLWNCDICLSKEDEEDDPLYQCDLCMVVVHPACYRRDLYDEVMQNSDCEDEPWFCARCK
HLINEQPPANKLPNCFLCTDLLGSMIDLDSKEWVHQSCVNWHDDIWFNEKDTKYRKFEGK
LDYERFSLTCYICNIKQGACIQCDLKSCQKAFHVRCAIKERLIVSTEEMEDLRLGSWDVK
IFCGKHTNIGKKKVQKIQLQKFLSTNCNKDVAKLISLDDQESEQDRVTRRQAMIMANQQQ
QQQRKRKSVINEIDIDKIMEDDFEKVQSPPKNLLLNPTPNIPKYLDSKINIIGIDRNVSG
LASISCEVQQQIPKQEDKQQQQRSASNKARRSNNGFVPDFSKCEVIRPGGLAQESTSDIQ
KKPLAQNPLIKPKQNPSSGNNQITNSTAQASLQAKPLITQNDFLPKQQIQVINPNEQQQQ
QTSGGASRLSSTGFLSTKPRPLPNPSSNIQSFLGADPRLQVSSNQQADNVVSKPSGFLDV
QKSAKNQVKSAELNLESINTENPHKFKINKKLQDILRIPEQRVTYKDFTLALFRFHKQVG
NFYDKPTSTFDLSKYPQFRVFWPNHSRIGQDDIKRYLLGLQI