Identifiers and Description

Gene Model Identifier

Contig13026.0.0.g39

Standard Name

NTO1d

Aliases

Contig13026_0_0_g39

Description

PHD-finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR031W0.000000100009565553302NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13026.0.0.g39(coding)
ATGTTGAATAACTTTAGCTATCAACCTCAAAATAATCAGTAATAATAGTAACTCTAAAAC
TCATCGACTTATTTTTATTAGTAACAGCAGCAGCAACAACCATTAATCCCTCCAGCACCC
TATAACCCAGCTAACAATTAAAATGTATTGAATATGATTCCACCAGTGTATCTGTCAAAT
CCCTCTAATACTTAGTTAAATGAAGAGGCACTTAATCAACTCAACACTGTTGTGGCTTAA
TAGCTGTAGAAAAAGCAGCAAGAATAAAGGTAGTAATAATAAATGCAACAACAAATATAA
TAGTAACAAACACAACAATAGCAGTAATAACAACAGCAACAACCTTAATATTAACAAACC
ATTGCTCAGCAATTGTAACAGCAACAATAATGCGCTCAATAAAACTAATTATAAGAGCAG
TAACAGAATAGAGTTCAAACTGAAAAGAAGCCATAAACCAAAAAGAACAAGGATTAGTCG
TAAAATTCCACAACTACTGCCACAAGCTCAATAAATCTGAAGAGAGTGTTGAGTCCCATC
CCAGAACAATTTGATGAGGAGAGCAACATCACTACAATTATGCAGTAACAGCAATATTTC
AGAGATTCCGAGCAGAAAGAGCTTGAGGACCAATTAGAAGAGGACTAGTAAGAATTCACT
GAGTATGAGGATACACAGGTTAGGTAACTTAGTTAGGAAAAGCCACTAGAAGCTTAATCG
CAAATTATCACTAACATCACAACAACCACTACCACAACGACAATTATCTCATAGTTTAAT
ATTTGCACTCCATCAATAGCATTGTAAAACGTGCCTTCACAACAGGAAGTTTAGCATTAG
TCAATGACTGATGCTACCACTGTAGAGAGTCTTAATAATAATACTGATTTGGATAAAGCT
CTCACTTAGCATGAAGAACTTGATAATAATACTACTACTTAAGAAGAACTTCTCTCATCT
AGTCAGCTGTAAGATAATAAAGTCAAGCAGCTATAAGAAGAGAGTCTGAAGTTCCTTAAT
TAAATGACTTTTATACAAATTAAATAGCAATAACAGTTGTAGCAACAAGTTACTGATCCA
CCTTGTGATTCAAAGATAGAGCAAGAAGTCAAACAATTACAGGAGGCCGAAGACGTCAAA
ATGGATTAAGAAGTTGAAAACGCCGTAATGGATATAGAAGTTGAAGATGTAAAAATGGAT
GAAGAAAATGCTCTAGAGTAAAACCACAGCTAGAAAAGCTCATAATAGAGCTAAATTTAC
TCTCCCTCACCATAGCTGTCTTAAAAAGAAATCAACACTGTAGAGTAATAGCTAACTCAA
CATTTATAAGAGACTCAGTTAATGTTAGACACCTAAACTTAATATCAAAATAACTCTCAA
ACTTAGCATTAAAAGGAAATTACTGCTCTTAACCAATAAACAGATTCATAAGAGAGTGTT
AAATCAATGAAGTAATAAAAATAGTAGGTAAAAGAAAAAGCTCTCAAAGAGACTTGCAAT
AATAATTCTCCTCCTAAAGAAAACAAGCAAGTTCAATAAAATATACCGATTTAACAGCCA
GTTAGAATGCAATAATTATAAAATGGTAAAATGACTAGTTCAAATTTTTAAAAGCCAACA
ATAATTAGAAACGAAAGCTCTTGTGACGAAGATGAAGAAGAAATTTAAGACTTAGATGAG
ACTATAGAAGATGAAGAAAGCATAAAATAAGACAAAGCTATAAGCCAGAGCAATTAATCT
GTACTACGAAGTTAGGGATAGGTACTCATTACAAAGCAGAGTTAAATCTAAAGCCAGAGA
AGAACTTAAATAACTCAAAGAGGTGAAACTTAAAAAGCTAGAACATAGCTAGACTAAGAA
AATGAACAGGATGAAAAAAATTAAGAGTTAACTTCAGACATCTGGCTTCAAAAGTACCCA
GAAATTGTCTTGGTAGAAAATGAAAATGATGAGAATGTAAAATGCGAAATTTGCTTATAA
TTTGAGTCAGAGGACCAAGATCAAATTGTGCTTTGCAATTTATGTTTATGCTCAGTGCAT
CAGTCTTGCTACGGAAAAGAATTAGCGAAGGGCTTACCAGAAGATGAATGGATCTGCTAT
AGATGTTAAATGCTAATAAAAGATAAAAATCTCAGGCCCTCTGATATGGTTTGTGGAATT
TGCAGTAAAAACAAAGGAATAATGAATGGATCCATCCTATATGTGCCAATTGGAATAATT
TCATATATTTTGAGAATTCTATAAGAAAAAATTAACTAATCAATGATTTTGAAGGGCTTG
AAGCAACTATAAAATGTTAAGAAAATATTCTATGCTATATTTGTTTGGATTGGAAAGGCT
TAAAAATCTAATGTGATTGGACTAATTTTTGACTTTTTAAAAATGAAAGAATAAGGCTTT
TATGAGCCAAGTAACACTACAACAGTCTATAAATTTTGTAAAGATCATCAATCTAAGGGA
ACAAACTACATTAAATAAAAATAATTCATTTCATTGAAGATTCCTTAATCTAAAACACTA
AATTTTCCATTCAAACAATTAAAACGATATCACGACATATTTAAATGTTCAGACGAGGAA
GATGAGTAAATATTGGGTTCAGACGAAACTTACGACAAAAAACTTTTTCAGTAAAAAGTA
TAAATGCCAATTATTGAGGCCTAACTATAACCTTAAAAATTCAAAAGAGCTTAGACCCCA
AATCCCCACATGAGTGAGTTTGATTAAGACCTTACAGATATTAGAGTGCCTAAAAAGAGA
GGAAGAAAGCCAGGTATTCCAAATAGACCTAAAGATAGCCAAATTGAAGTAAATTAAAAT
AATGAAGAGGAGATTCCTTAACAGCTAGATACTTAAACACTACCAAATATTTAAGAAATA
AAAAAAGAAAGGAAAAAGCGAGGGAAGAAGAGCTAATTACTCATTAGATAAGAGCTGCTT
GACTAAGCAAATAAAAGTAGTGATACTGATGAATTAATATAAAGCGATAACTCAGATTTA
AATAAAGTCCATCCTAAAAGTGATGCCTAACTTGACTTAAATGAAGGTCCTAATAAGCGC
CAAAGATTAGATAGCCAAGCCTAAAATCTAGCACAAATCCCTCTTAAAAATGATCCGAAT
TCAGTTTAAAATCTAAATTTTAATCCATTGTTACAAGCAAATTTATAAGGATTGCCACAA
TCCATCCCTTAACAAATTAACCCACTTTTAATGCTTCCTTAACTTTAAGTAACGGCTTTT
CAATAGTAATCGATACAGAACATTCCTTAAGCTTAAAATGATTTGATTCAATAAGCCTTA
ACCAATTTTCAGTTGCAATAGTATTATTTATAAGCGTAAACTCAGTTGGCTTAAGCTCAA
TAGTTTCAAGTGGCTTATACAACCTAAAATGTCTAATAGTAATAATAAGTTAGTAGTAAT
ACGAATCCATAGTTCAAACTCCAAGATGAACTTGAAAATGTATTGAATAAATTGGGTTAT
AATTTTAGCAATTAAGATCAACAACAGGTAGTAAATTATATTATGGCACTTGGCATATCA
ACTTTCTTAGATAGATCAGGATTGAGAAACTCCCGTAATTCTTAACAATTTTCTCAAAAC
TTGATTGAAAGTACTATCTAGAATTAAAGCCAAATTTAGAGTATATTGAAAAAACCAAAG
CAAAGCCAAAGTTTAGACAATACTGCAGTAGAATCATGTGACCAGGTCTCCTAGAAAACT
CAAAGAAAGCATAAACAAACAACATTTAAACTGGACCCTAAATCATTAAACAAAAATATC
GAGCAAGTTGAAGAGCTAAAAAATAATTCAGTTTAGGATTAAGATTAAGAATAATCAGTT
TAAATTGTTTAAGAAGACGCCGAAATACATAAATTACAAAAAGAGAGAAAGAAAAAATAA
AAGAAGCATAAAAAACATTCTGGAATTGTAGAGTCTTAATTTGAAATTAAAAAGGAATAA
GATAATAACTAGGAAGCCTAATTAAATCCTGAAATTCATCAGGACTCATAAATTAAATCA
GAGTAAAAGAATGACGATGAGCTTGAAATATAAGAACAAATCATTGTTGAACCTAAAATA
GAGAAATATATACTTGATCATTAGCTTTTTAGAATACTAAAGTTTATCGAAGACTTGCTC
TTTAAAGAGAGACATACAGATGCCAAGATTAACAGATAAAATCATAATCAATTTTAAACG
ACCCATCAAGCAACTACAGATGATTCAGAAGATGGTTTTGAGCGCATATTTATCGATGAG
CAGGGTGAGTATACTCAAGCCCAGATTGAGGACAGATTCTTAAAAATTCTTACTACTACG
ATATTGCCAACTCAGGCATACTTGTCAAAGTTTTTAATACAAGTGAGTCTCTGA


>Contig13026.0.0.g39(protein)
MLNNFSYQPQNNQQQQQLQNSSTYFYQQQQQQQPLIPPAPYNPANNQNVLNMIPPVYLSN
PSNTQLNEEALNQLNTVVAQQLQKKQQEQRQQQQMQQQIQQQQTQQQQQQQQQQPQYQQT
IAQQLQQQQQCAQQNQLQEQQQNRVQTEKKPQTKKNKDQSQNSTTTATSSINLKRVLSPI
PEQFDEESNITTIMQQQQYFRDSEQKELEDQLEEDQQEFTEYEDTQVRQLSQEKPLEAQS
QIITNITTTTTTTTIISQFNICTPSIALQNVPSQQEVQHQSMTDATTVESLNNNTDLDKA
LTQHEELDNNTTTQEELLSSSQLQDNKVKQLQEESLKFLNQMTFIQIKQQQQLQQQVTDP
PCDSKIEQEVKQLQEAEDVKMDQEVENAVMDIEVEDVKMDEENALEQNHSQKSSQQSQIY
SPSPQLSQKEINTVEQQLTQHLQETQLMLDTQTQYQNNSQTQHQKEITALNQQTDSQESV
KSMKQQKQQVKEKALKETCNNNSPPKENKQVQQNIPIQQPVRMQQLQNGKMTSSNFQKPT
IIRNESSCDEDEEEIQDLDETIEDEESIKQDKAISQSNQSVLRSQGQVLITKQSQIQSQR
RTQITQRGETQKARTQLDQENEQDEKNQELTSDIWLQKYPEIVLVENENDENVKCEICLQ
FESEDQDQIVLCNLCLCSVHQSCYGKELAKGLPEDEWICYRCQMLIKDKNLRPSDMVCGI
CSKNKGIMNGSILYVPIGIISYILRILQEKINQSMILKGLKQLQNVKKIFYAIFVWIGKA
QKSNVIGLIFDFLKMKEQGFYEPSNTTTVYKFCKDHQSKGTNYIKQKQFISLKIPQSKTL
NFPFKQLKRYHDIFKCSDEEDEQILGSDETYDKKLFQQKVQMPIIEAQLQPQKFKRAQTP
NPHMSEFDQDLTDIRVPKKRGRKPGIPNRPKDSQIEVNQNNEEEIPQQLDTQTLPNIQEI
KKERKKRGKKSQLLIRQELLDQANKSSDTDELIQSDNSDLNKVHPKSDAQLDLNEGPNKR
QRLDSQAQNLAQIPLKNDPNSVQNLNFNPLLQANLQGLPQSIPQQINPLLMLPQLQVTAF
QQQSIQNIPQAQNDLIQQALTNFQLQQYYLQAQTQLAQAQQFQVAYTTQNVQQQQQVSSN
TNPQFKLQDELENVLNKLGYNFSNQDQQQVVNYIMALGISTFLDRSGLRNSRNSQQFSQN
LIESTIQNQSQIQSILKKPKQSQSLDNTAVESCDQVSQKTQRKHKQTTFKLDPKSLNKNI
EQVEELKNNSVQDQDQEQSVQIVQEDAEIHKLQKERKKKQKKHKKHSGIVESQFEIKKEQ
DNNQEAQLNPEIHQDSQIKSEQKNDDELEIQEQIIVEPKIEKYILDHQLFRILKFIEDLL
FKERHTDAKINRQNHNQFQTTHQATTDDSEDGFERIFIDEQGEYTQAQIEDRFLKILTTT
ILPTQAYLSKFLIQVSL