Identifiers and Description

Gene Model Identifier

Contig9084.0.g76

Standard Name

NTO1c

Aliases

Contig9084_0_g76

Description

PHD-zinc-finger like domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYPR031W9.000751454575209e-33NTO1 SGDID:S000006235, Chr XVI
from 631515-633761, Geno...
T. thermophilaTTHERM_004447000.000000000003998907168546896PHD-finger family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9084.0.g76(coding)
ATGAACCAAGACCAACTGAATAACTAAGCCTACTAACAGTATATGCAATAATAGTAGCAA
TTCTAACAGAACTAGTAATTCTATCCTGGTCAACAGCAATAGCAATTCGTACCACAATAA
CAAGCTCAGTAAGCAAATAACGGGAATCCATTCATGAATCAGTATGGAGATAGTACTACA
AACACTACAGGTTACATCAATCAACTACCAGGTGGAGTTCTTCCTTAATAATAGCAATAT
CAATAATATCCAGTTTAAAATGGAAGTTATCAGTAGAATGTCTAACAACAACCATTAACT
TCATTCGATTACAATAATGCCACATTTGGTTCTAGTTATGAACAGCCAGTTATCAATTAG
CACAACTTCCAAGCAGCTACTGAAAATTTGCAATAGCAACAAGTTTAAATCGATACTTCA
ACTAAGGGTAAAAAGAGAGGAGGTGTTCTTAACGCCATGACATCAGAAACAAAGAAAAAG
AAGAGATCTAACTCTAGTAATATTTGGAACAGCAAAAGTCGTAAAGCATCATAAAGGGCT
TAAAAACTCAAGAGAGATAAGATCAGAAATGAGCAAGGACTTGTTGGTCAATAAGCTAAC
CTAATTGACTAAATTAATACCTTGAACATAAATGGTAGTACATCCAGATCTAGGATCAGA
AAGCCTAGAGATTAAAGGCAGATGTAAGTCGATCCTTCTAGAGTAAATCCAGTTAGAGCT
ACAAAGACAGAGAAGAAAGATTACAATGAAACTAAAATGAGTCAGATTAATATTGAGCAA
TTCCCAAAGCCAGCCAAAGAGAGTAAACCAGAATTAGAAAAAATGCAAGTTGAGGACAAA
GATTCTTTCGATCCTAACAACCCATATGAAAAGATCATACTTAATCAGAATACCGAAGAT
GAAGATATTCAATGCGATGTTTGTTTAGAGTTTGATCACGAAGACGAGGATTAAATAGTA
ATCTGCGATCTATGCAATGTTGCAGTCCATCAATCTTGTTACGGAGGGGATATCATCAAT
CAAATCCCCGTTGGAAATTGGTACTGTGAAAGATGTACAATTTTAGTAAGAAATAGGGAA
ATGAAATGCGATTCAATAAAGTGCAAATTTTGTCCAGATGTCGATGGAGCTATGAAGAAA
TTGGTTGATTCTGACATGTGGGCTCATGTAATTTGCGTCAATTGGAATCCTGACATTTAC
TTTACAGATAAATATAAGAACAAAATTGAAGGTGTGCTTAATTCAAAAAGATATGAATTA
TAATGTAACATGTGCCATAGACCAAAAGCTTAAGGATGCTGCATTCAATGTGATTTTAAA
AACTGCTCAGCCTCATATCATGTAAGATGCGCAGTTAGAAGAGGAGTAATTGAAGAATGG
GATAAGATTTAGGAAAAAGCTGGAGTTGAAGATGAGCATTTTATTCCATTGTTCTGTGAG
GAGCATGCTGAAAAAGGATATAAGATATTTAAAGAGAATGGCAAGCAAGGGATTTAAAGT
ATCACACAGACTCCAGAATACAAACAAAAGTTAGCTGAAAGAATGAGATAAAAAGCTTAA
CTTCATCCAGGAAAGTTCTAAAAGAAATAAAAAGTCAGTTTAAGAAAACCAGTAGGCAAG
ACTTTGAATTTTAAGAATGGAATTAATCTTGGGAATAAAAAAGCAAGTAAAGCAATTCAA
GATGTAGTCAATAGAATCTCATCTCAAAGAGACAGCAGAAACAGCAAATCAAAAGTAAAG
AATGGCAAAAAGAGTAGAGAAGGATTGAGAAAGAGAGAGATCCCAAGACCACAACATAAT
TCAATTGGAAAGTAATCACAACTATTGAAATCTAAAAAGAAAATTATTGCATCATCAGCA
AGACCAAGCAGGCAAATCTAATCAAGTGCTCAAAACCATATGCCTGCTCAAAATCACATG
TCTGCTTAAAATCAATTCGATCCAAACATGCTAGCCTAATTTTCTTAGTTCTTTGGTCAA
ATGATGGGTTAGTAGCTCAATTCTTTCAACCCTAACTAATTCTAATCTTAGTTACCCCAA
AAGTAGTAGCAGTAGTCCAAGCCAATACCTTCAAAGACCAAGACAATCGGCAAAGGAAAT
TAAAAGTAACAAGTCCCAATCAAAAATCAGTAAGTTGATGATGAGGTGATGGAGGATACT
TCATCTAAAAGACCATCTCCAGGTTCATTCCTAAAAAAGCATCCAAGAACTAAGAAATAA
CTATCAAACAAAGCCGCTTCATCAAATCAAAATTAGAACTCTACTAACAGCAGTGTAATG
GCAATCAATAATCTCTACCCTTAAGCCCCATTCAATCCATACCTTGGCACTCCCATGATT
AATCCTGGCATGTTTGGAAGCGGACAAGCATTGCCAAAGCCCTTCTGA


>Contig9084.0.g76(protein)
MNQDQLNNQAYQQYMQQQQQFQQNQQFYPGQQQQQFVPQQQAQQANNGNPFMNQYGDSTT
NTTGYINQLPGGVLPQQQQYQQYPVQNGSYQQNVQQQPLTSFDYNNATFGSSYEQPVINQ
HNFQAATENLQQQQVQIDTSTKGKKRGGVLNAMTSETKKKKRSNSSNIWNSKSRKASQRA
QKLKRDKIRNEQGLVGQQANLIDQINTLNINGSTSRSRIRKPRDQRQMQVDPSRVNPVRA
TKTEKKDYNETKMSQINIEQFPKPAKESKPELEKMQVEDKDSFDPNNPYEKIILNQNTED
EDIQCDVCLEFDHEDEDQIVICDLCNVAVHQSCYGGDIINQIPVGNWYCERCTILVRNRE
MKCDSIKCKFCPDVDGAMKKLVDSDMWAHVICVNWNPDIYFTDKYKNKIEGVLNSKRYEL
QCNMCHRPKAQGCCIQCDFKNCSASYHVRCAVRRGVIEEWDKIQEKAGVEDEHFIPLFCE
EHAEKGYKIFKENGKQGIQSITQTPEYKQKLAERMRQKAQLHPGKFQKKQKVSLRKPVGK
TLNFKNGINLGNKKASKAIQDVVNRISSQRDSRNSKSKVKNGKKSREGLRKREIPRPQHN
SIGKQSQLLKSKKKIIASSARPSRQIQSSAQNHMPAQNHMSAQNQFDPNMLAQFSQFFGQ
MMGQQLNSFNPNQFQSQLPQKQQQQSKPIPSKTKTIGKGNQKQQVPIKNQQVDDEVMEDT
SSKRPSPGSFLKKHPRTKKQLSNKAASSNQNQNSTNSSVMAINNLYPQAPFNPYLGTPMI
NPGMFGSGQALPKPF