Identifiers and Description

Gene Model Identifier

Contig9879.0.0.g14

Standard Name

NTG1

Aliases

Contig9879_0_0_g14

Description

HhH-GPD superfamily base excision DNA repair protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011061204.0018838296491823e-56HhH-GPD superfamily base excis
ion DNA repair ...
SGDYOL043C8.001824328206442e-49NTG2 SGDID:S000005403, Chr XV
from 249534-248392, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9879.0.0.g14(coding)
ATGAAATCTCAGTAAGCCACTAAAAGTAGAGAGTTAGAGGGAAGTGAAAATTTCATTCCA
GAGGACTGGCAGAAACTTTGGGATGTCATTATGGTCATGAGGAGTGAAAATCCTGCTCCA
GTTGATAGCATGGGCTCTTCTTGTTTAGCAGATTCAAACGCAACACCTAATGAATTTGCT
TTCTAGACATTAATTGGACTAATGCTTTCTTCATAAACTAAAGATGAGGTTACTGCAGAA
GCTGTAGGAATTCTACTATAGAATGGCCTCTCCATTAAAATGATTGATGAAATTAAGGAA
TAAGACTTGAACAGACTTATCGAAAAAGTAGGATTCCACAATAAGAAAGCAATTTATTTG
AAGAAAGCCGCAAGACAAATAATCGAAGACTATAAGGGGATAGTTCCATCAGATTATGAC
AAGCTTATTGCATTACCAGGTGTAGGTCCTAAAATGGCTCATTTGCTTCTGTAGAATTGC
TTTGATAAAACTGTAGGCATCTCTGTTGACACTCATGTTCATAGAATTGCCAACAGATTA
AAGTGGGTACCTAAACAAACTAAAACACCTGGCGAGACAGCAAAAGCCCTCTAAGAATGG
CTTCCTTAAGATAAATGGGAGAAGATTAATTGGATGCTGGTAGGATTTGGATAGATGATA
TGCAAACCCATAGGACCCAGATGTTATGAATGTAAAGCGAGAGACTTATGTCCTTTTGAA
CCTAAAAGCAAGCCTCCAACTAAGTCCAAATCTAAAATTGCAATTGTTAAGAGTAATGAT
GATGGGGTTATAAACTCAACGACTTAAATAGATATAGAAGAGGAAGTTAAAGAGCAAGAT
CTAGGCTTCATAGAAAATTAGGGAATAAAGACCTAGTCGAAAACTAAAAAAACAAAGATT
AAAAGTGTAAGCTCAAAAAGTAAAGATTATGATAAAATAACAATACAAAATAAACAAGAA
GCGATTGCTCATGATTAAGTTTTGGATAATCAATAATAAATTAGTGAAGTAAGTAGCAAA
GAAAATAAGGAAGAAATTAAGAATTCAAAAAAGAGAAAGATGAATGCTCTTGATAATTTC
AAATTTGTAGATAAAACAAACAATAAACGCAAAAGATGA


>Contig9879.0.0.g14(protein)
MKSQQATKSRELEGSENFIPEDWQKLWDVIMVMRSENPAPVDSMGSSCLADSNATPNEFA
FQTLIGLMLSSQTKDEVTAEAVGILLQNGLSIKMIDEIKEQDLNRLIEKVGFHNKKAIYL
KKAARQIIEDYKGIVPSDYDKLIALPGVGPKMAHLLLQNCFDKTVGISVDTHVHRIANRL
KWVPKQTKTPGETAKALQEWLPQDKWEKINWMLVGFGQMICKPIGPRCYECKARDLCPFE
PKSKPPTKSKSKIAIVKSNDDGVINSTTQIDIEEEVKEQDLGFIENQGIKTQSKTKKTKI
KSVSSKSKDYDKITIQNKQEAIAHDQVLDNQQQISEVSSKENKEEIKNSKKRKMNALDNF
KFVDKTNNKRKR