Identifiers and Description

Gene Model Identifier

Contig20089.0.g114

Standard Name

NSUN5

Aliases

Contig20089_0_g114

Description

NOL1/NOP2/sun family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006229202.0003218023735366e-33conserved hypothetical protein
SGDYNL022C2.000470901975128e-28YNL022C SGDID:S000004967, Chr
XIV from 592899-591427, G...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20089.0.g114(coding)
ATGAAAGTATACAAACATGCCTCACAAATTATATAAGAAATTACAGAGCAAAATAAAGGC
TTTAAAACTGGTTACTACGACTATTATGAGAAAAATAAGCATACTTTTGGGTCTCAAATG
AATAGAATTTATTCTGTGTCTATTAACACGTACAAGAGATATAGAGATATTAAAGGAGCT
ATTGAGCAAGTGTTTAGCAATGAGAATGTTAGAGATTATTACTTATTAGTAGTGTTAATA
CATGAAGGAGCAATTATGAATGAAAAGATTAAAATCGGTGGTAAATTGAGTAAAATGGTC
AAGACTCACAAAGAGGAGTTATAAGCTATCCTTGGAATCACTGATTAAGAAAGCAAAGAA
GATGAGGTAATTTACATAAGACAAAACAAGCATATTGAATAAGAATTAAGTTTGAAAGAA
GTGAAGAAACAATTAAACGAAGAAGACTTCAAAGTCAAGAAAGTTGGAAAATTAGACTTA
CTAAGAGTGCACTAAACTAAAAGCAAGACTGTAGTCACGCATCCCTTTTTTAAAGAGCAT
AAATTTGTTATTCAAGACATATCGAGTTGCATGCCAGTGATGTACTTAAACTCATTTTTG
TAAGGTAAATATCGTGAGGGTAAAATCAAAGATTTTCATGGTATTGATGCAACTTCCTCC
CCAGGAAATAAATCTCTGCAGCTATCTGAAATCATTGGCAAACTGTATAGTTTAGAAATG
GATTAGAAGAGATATGAGACATTGAAGCGTAGAGTAGAATAATGTTAAGCCAAGAATATA
GAATGCTTGAATTATGATTTCTTGAACACAAACCCAGAATCTTATGAAGATGTAAACGTT
ATAATCTGCGATCCATCATGCTCGGGAAGTGGAATGAAACTCCATGCTCAATAGAATTAA
GAATGTACATCTGGACTTGCTACACCAGATGAAATGAAGACCAGAGCATAGAATTTATCA
AAGTTTCAATTTAAAATCGTTTCACATGCATTAACATTTCCCTCTGTGGAATATGTTGTG
TATTCGACTTGCTCTCTCTATGAAGAAGAAAATGAAAATGTTGTCAGAGATATCTTGAAA
AAGCACAAAAGAACTTGGAAGACAGTTGATCTTGAGAAAATAGATATAGGTTTAAGCAGT
AGATATCTGAAAGGTTTCCACTTTAACAAAAATAAAAAGTAGGGTCACTCTCTGAGACTA
TGTTCAACCTGTGGACCAAAGAATTACCTCAACGGATTCTTTTTGGCTATTTTTGAGAGA
AAGAGTATCGCTGAGAATGAATAAGAGTGA


>Contig20089.0.g114(protein)
MKVYKHASQIIQEITEQNKGFKTGYYDYYEKNKHTFGSQMNRIYSVSINTYKRYRDIKGA
IEQVFSNENVRDYYLLVVLIHEGAIMNEKIKIGGKLSKMVKTHKEELQAILGITDQESKE
DEVIYIRQNKHIEQELSLKEVKKQLNEEDFKVKKVGKLDLLRVHQTKSKTVVTHPFFKEH
KFVIQDISSCMPVMYLNSFLQGKYREGKIKDFHGIDATSSPGNKSLQLSEIIGKLYSLEM
DQKRYETLKRRVEQCQAKNIECLNYDFLNTNPESYEDVNVIICDPSCSGSGMKLHAQQNQ
ECTSGLATPDEMKTRAQNLSKFQFKIVSHALTFPSVEYVVYSTCSLYEEENENVVRDILK
KHKRTWKTVDLEKIDIGLSSRYLKGFHFNKNKKQGHSLRLCSTCGPKNYLNGFFLAIFER
KSIAENEQE