Identifiers and Description

Gene Model Identifier

Contig13211.0.g84

Standard Name

NSUN2b

Aliases

Contig13211_0_g84

Description

NOL1/NOP2/sun family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006845402.000383902553626e-98NOL1/NOP2/sun family protein
SGDYBL024W2.9986068920536807e-84NCL1 SGDID:S000000120, Chr II
from 172534-174588, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13211.0.g84(coding)
ATGGAATCGACATCAACTATCACAGATGGTAATAACTAATAACAAGTAAGCAATAGAGAC
AAGAAAGCCAAGAAATGGAATAAGTTTCAAGAAACTAGAGAAAAAAACAAAAAGAAATTG
CAGAGAAAGTTTGAATACTGGGCTAGCAATCCCGATGGATAAAAGCCCAAGAATAAAAAT
GGAGAGGGAGATTATAAGTAGATTGAGTACAAGATAGGCAATGTCAACTTTGATGAATAC
TATCAAAAGTAATTCCCAGATGTCTCAGCAGAGGAATTCAAGCTATTCACAAGCACTCTC
TAAGAGAAGTTACCAGTTACATTTAGAGTAAATTAAACTGAAATACATCACGAAAGAGTA
GTGGCTATATTCAAGGATCCAAACTATATTAAATCTAACTTCACAGCTCATGAAGAAATC
TAGTCTAAAGAGGTCATGAGTATGGACATGAATTAAAGGACTGAACATCAAGAAGGTATT
AGAAATGCCAATATTGATGTAAGCCAGGTCATATTAGAGAACAAGACTTACTACCCCCCA
GGAGATGTCCTCTTCGAGCTTACAGTTCCAAGAGAACTTTTGAAGAAAAATGTTGGATTA
AAAGCAGTACATAAACTGATGTAGCAAGCAAACGATTCAGGACTGCTAACAAGACAGGAA
ATAGTCAGTATGCTCCCACCTCTTCTGCTTGATATTCATGCTAATCACGCTGTATTCGAT
ATGTGTGCTGCACCAGGTAGTAAAACAGCTCAAATATTCGAAATCATGATGACTGACTAA
CTCTATGGTGGAGCTTCTGGCTCAAATATTGAAGAACCAAAGGGATTCGTTATTGCAAAC
GATTCAGACAGCAAGAGAGCTTATCTACTTACTCATCAGTTAAACAGGTTCAATACCTCA
AATATAGTGGTATTGAATCACAATGCTCAAAATTTCCCCTCATTGCACTATAAACTTGAT
TAACAACCAGGCAAAGAGGAAGGATTAGACACTAGAGTCCTTTACGATAGAATCGTCTGT
GATGTGCCATGTTCATCTGATGCAGCTATTAGGAAAATTCCCTAAAAATGGGATAAATGG
AGTCCAGCTGATGGCGCTTCTCTGCATGTACTATAAGGTAGAATTTTATTCAGAGGTTTG
CAACTGCTGAAGGTTGGTGGAAAAATCTCTTATTCGACATGCTCCCTGAATCCAATTGAA
AATGAATCCGTAGTAGCCATGGCTTTGAAAGCTTTCCCTGGTTGCATCCAACTTGAAACA
GTAGAAGTTAAAGGTTTCAATTTTAGACCAGGTTATACTAACTGGAGAGTGTTGACTATA
AATAGAGAGAAAGAGAAGTTAGAAAACTAAGAAGAAAGCAAGGAAAGTCCATTTATTGAA
TTTGAGAATTTCGAGCAAGTCACATCAGAATATCTATGTAGAGGAATTAAAGATACAATG
TTTGCAAGCCATTATGACGATTCAATAAAATAAGAATTAGTGAAGTGTCTTAGAGTTTTC
CCTCACGATCAAAACACAAGTGGCTTTTTTATTACAATTATAAAGAAAATCAAAGAATTC
GATCATTCATTAGAATGGTAGAGTAAAGTTTATAAGAATAACGAGGAATAGAAGCAACCT
GCAGTTGAGACTTAATAGGCATCAAAAGATGTGAAGCTGCCACTGTAAATCTAAGCTAAA
AATAAACACATCTAATTCGAATTCACCCGTTGTGACCCCAAAGACCCAGACATAGAATGG
ATAAAATCTTACTATGGATTGACAGATGACTTCCCAGTTGATCAGCTAGTGACTCAATCC
TCAGAGATGAAAAAGCTTTTCTTTATCTCTCAATCAGTCTCCAAGTATCTATATGCTGAC
GTGTAGCATCATCAATTGAACATTATTAACATGGGAGTCTAAGCTTTTATGAGAAATACA
AGCAAGTATGGCTAGGGTTCAGAGTGCATATTCCGTATCTATCAAGACGGTGTATTGAAC
ATAGTCCCCTATATGACAAAGAGGTTAATTCATGCAAGCAGTGAAGACGAGTTTAAGCAG
TTCTTAAAGCATAAGATGCTTGATATCGAGGAAATTCAAGGTGAGCAGTTGAAGAAAGAT
ATTGCGGACCTCACAGGTGGATGCTTCATTTTGGCATTGAAGATTGGCTAGAACTATGAA
GCATTAACAATGCATAAATTCCCAAAGCAAGTTTCACTTATGATAAGCAAAGAAGGCATT
TTCAGCTTGCATTTAAGATATCTAAACAAAGAAGAGAGATTGGAGAGCGCTAAAGTTTTT
GAACTTGACAAATGA


>Contig13211.0.g84(protein)
MESTSTITDGNNQQQVSNRDKKAKKWNKFQETREKNKKKLQRKFEYWASNPDGQKPKNKN
GEGDYKQIEYKIGNVNFDEYYQKQFPDVSAEEFKLFTSTLQEKLPVTFRVNQTEIHHERV
VAIFKDPNYIKSNFTAHEEIQSKEVMSMDMNQRTEHQEGIRNANIDVSQVILENKTYYPP
GDVLFELTVPRELLKKNVGLKAVHKLMQQANDSGLLTRQEIVSMLPPLLLDIHANHAVFD
MCAAPGSKTAQIFEIMMTDQLYGGASGSNIEEPKGFVIANDSDSKRAYLLTHQLNRFNTS
NIVVLNHNAQNFPSLHYKLDQQPGKEEGLDTRVLYDRIVCDVPCSSDAAIRKIPQKWDKW
SPADGASLHVLQGRILFRGLQLLKVGGKISYSTCSLNPIENESVVAMALKAFPGCIQLET
VEVKGFNFRPGYTNWRVLTINREKEKLENQEESKESPFIEFENFEQVTSEYLCRGIKDTM
FASHYDDSIKQELVKCLRVFPHDQNTSGFFITIIKKIKEFDHSLEWQSKVYKNNEEQKQP
AVETQQASKDVKLPLQIQAKNKHIQFEFTRCDPKDPDIEWIKSYYGLTDDFPVDQLVTQS
SEMKKLFFISQSVSKYLYADVQHHQLNIINMGVQAFMRNTSKYGQGSECIFRIYQDGVLN
IVPYMTKRLIHASSEDEFKQFLKHKMLDIEEIQGEQLKKDIADLTGGCFILALKIGQNYE
ALTMHKFPKQVSLMISKEGIFSLHLRYLNKEERLESAKVFELDK